Answers.com

Neuromedin B

 
Wikipedia: Neuromedin B
 
neuromedin B
Identifiers
Symbol NMB
Entrez 4828
HUGO 7842
OMIM 162340
RefSeq NM_021077
UniProt P08949
Other data
Locus Chr. 15 q11-qter

Neuromedin B (NMB) is a bombesin-related peptide in mammals.[1][2] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.[3]

Contents

Sequence

The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromein B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is : TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[4]

Function

Figure 1: NMB, 7-TMR receptor and G-protein
Figure 2 : Signal Cascade after NMB binding

Neuromedin regulates the following functions:

  • exocrine and endocrine secretions
  • cell growth
  • body temperature
  • blood pressure and glucose level

Neuromedin signaling pathway

NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7 transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see Figure 2).

When NMB binds to its 7-TMR, the heterotrimeric G protein that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of GTP for GDP bound to G-α subunit. The G-α subunit in turn dissociated form the G-βγ subunits. The free G-α iactivates adenylate cyclase (AC) which in turn catalyzes the conversion of ATP to cAMP, the later which functions as a second messenger. cAMP activates of the enzyme Protein Kinase A (PKA). PKA enters the nucleus and activates the cAMP response element-binding protein. The activated CREB binds along with CREB binding protein, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by leucine zippers. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes.In the brain, CREB plays a role in long-term memory and learning.

References

  1. ^ Ohki-Hamazaki H (October 2000). "Neuromedin B". Prog. Neurobiol. 62 (3): 297–312. doi:10.1016/S0301-0082(00)00004-6. PMID 10840151. 
  2. ^ Jensen RT, Battey JF, Spindel ER, Benya RV (March 2008). "International Union of Pharmacology. LXVIII. Mammalian bombesin receptors: nomenclature, distribution, pharmacology, signaling, and functions in normal and disease states". Pharmacol. Rev. 60 (1): 1–42. doi:10.1124/pr.107.07108. PMID 18055507. 
  3. ^ Krane IM, Naylor SL, Helin-Davis D, Chin WW, Spindel ER (15 September 1988). "Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin". J. Biol. Chem. 263 (26): 13317–23. PMID 2458345. http://www.jbc.org/cgi/content/abstract/263/26/13317. 
  4. ^ Wada E, Way J, Lebacq-Verheyden AM, Battey JF (01 September 1990). "Neuromedin B and gastrin-releasing peptide mRNAs are differentially distributed in the rat nervous system". J. Neurosci. 10 (9): 2917–30. PMID 2398368. http://www.jneurosci.org/cgi/content/abstract/10/9/2917. 

External links



Search unanswered questions...
Enter a word or phrase...
All Community Q&A Reference topics
 
 
Learn More
Neuromedin
Bombesin
FMRFamide

Post a question - any question - to the WikiAnswers community:

 

Copyrights:

Wikipedia. This article is licensed under the GNU Free Documentation License. It uses material from the Wikipedia article "Neuromedin B" Read more