0
What else can I help you with?
What are some non examples coefficient?
Green, the sun, a motor car, heat are all non examples!
What are some examples of non integer rational number?
Some examples are 1/3, -4/7, 5 3/4, -6.37
What are examples of non-count?
The term non count is in reference to items are nouns that we cannot count. It is things that cannot be plural. Some examples are, luck, hate, laughter, beauty and patience.
What are the other examples of sentences for metaphor?
1.the camel is the ship of the desert2.variety is the spice of life
Can you give 50 examples of non- count nouns?
Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance
What are some examples of metaphor for power?
Some move matter with their mind.
What are some non examples of media?
some examples of non print media are ...
Are metaphors count or noncount nouns?
A metaphor is a word or phrase that is used to make a comparison between two people, things, animals, or places. A metaphor can be a count or a non-count noun. Examples: Their voices were of angels. (the metaphor 'angels' is a count noun) Your voice is music to my ears. (the metaphor 'music' is a non-count noun)
What are some non examples of omnivores?
What are non examples of omnivores
What are some examples of non tax revenues?
what are some examples of non-tax revenue
What are some non-examples of protein?
Water, vitamins, and minerals are some examples of non-proteins.
What are some examples of metaphor to an elephant?
back bat page 89
What are non-examples of glucose?
Some Non Examples Of Glucose Is Hoodies,Hair,ClothesEtc..
Can you show some examples of using the word metaphor in a sentence?
Harold considered himself a Master of Metaphor; his English teacher wasn't so sure.
What are some non examples of landforms?
non examples are anything made by a human on land that is not natural
What are examples of sentences of metaphor?
tae
What are some non examples of chloroplast?
what the answer
