Unanswered | Answered

Scrabble

~2008100 answered questions
Parent Category: Board Games
Questions about the game of Scrabble, the crossword-like word game. Super Scrabble questions are also appropriate. Questions about the electronic versions of Scrabble may be included here as a second category, but would be more appropriately be placed in a Video Games category.
at hi sat mathmatics ate eat cat sit hit mat heat meat seat is it him she sim
Popularity: 94
No. No, but 'woe' is a word. woo is a word it may be in other languages like Ghana or Chinese etc......
Popularity: 26
its because of phonetics q always contains the sound of u. q isn't a full consonant it takes u with it. so while making words q is always accompanied by u
Popularity: 1
The best tool for finding words that begin with any particular letter is a hard-copy dictionary, which lists words in alphabetical order. For a somewhat shorter list without definitions, try one of the many "spelling dictionaries" available. Words that start with J include: jab jabber jack jac…
Popularity: 20
A game of Scrabble ends when all the letter pieces to be distributed among the players have run out and the remaining letters (the last letters the players have) cannot be used in forming new words. Or, when a player uses all of his/her letters, you finish the round. Whoever has the most points wins…
Popularity: 44
OBAFGKMN represents the spectral types of stars in order as seen on the Hertzsprung Russell Diagram.A common mnemonic device for this is: Oh Be A Fine Girl Kiss Me Now.They stand for the diffrent classes of stars. They are put in these classes depending on what color they are and how hot they are.Th…
Popularity: 72
There are 225 SMALL (1x1) squares on a 15x15 board. There is a total of 1240 squares including multiple sizes.
Popularity: 35
Depending on the position of the board and the tiles presented on your rack, any word can be a good word. Example: HI is a simple and common two letter word, put when placed on a triple letter score and forming a second word in the opposite direction, you score a minimum of 26 points, which is rathe…
Popularity: 64
The letters tahberd make the word breadth.
Popularity: 1
English words beginning with dw: DWARFDWARFISHDWEEBDWARFISMDWELLDWEEBIERDWELTDWEEBISHDWINEDWELLERSDWARFSDWELLINGDWEEBSDWINDLEDDWEEBYDWINDLESDWELLSDWARFISMSDWINEDDWARFLIKEDWINESDWARFNESSDWARFEDDWEEBIESTDWARFERDWELLINGSDWARVESDWINDLINGDWELLEDDWARFISHLYDWELLERDWARFNESSESDWINDLEDWARFISHNESSDWININGDWARF…
Popularity: 27
endways Newsday (if you allow proper nouns)
Popularity: 32
Alfert Mosher Butts invented Scrabble. It was created in 1938 and the trademark process was completed in 1948.
Popularity: 22
I think that there is a total of 107 two letter words in the English language.
Popularity: 5
kangaroo Keep KellyKelp ken KeyKid kin kind Kindergarden kiss kit kite kith KneadKnee knight knit knitting KnivesKnot know known knowing knowingly knowledge koala king karot
Popularity: 14
VineVeryVisualVivisulaVaginavivisectionventricalvisitorventilationvariablevroom
Popularity: 2
Iraq. (that is a proper name sort of different) but...... tha word "tranq" is a valid
Popularity: 15
theretheirstaircaresstarewhereleakswavespaceslovestailsgrategreatstoutlaughjailsgreetsleet sheetsheeppeacegradebladeshineblind
Popularity: 7
Answer what four letter word can be made There are many answer for this question!!!!!!!!! A plenty are listed below!!2# PARK PEAK PORK PECK PEEK PERL (a knitting term) PERM Shocked!!!!!!!!! there are still more.... pert perf peri perp Also changing other letters (and not being…
Popularity: 29
Answer Jacksonville Jaguars. New York Jets Winnipeg Jets (ex-NHL team) Utah Jazz
Popularity: 12
Answer If you add the letter R and re-arrange the word sheep you get the word Sphere which in a sense is a globe.
Popularity: 6
There are five (5) different colors on a standard scrabble board. The colors, its number of squares and score are: red (8 squares) =triple word score pink (17 squares) =double word score dark blue (12 squares) =triple letter score light blue (24 squares) =double letter score offwhite (164 square…
Popularity: 4
Better check those letters. They don't unscramble to any one English word.
Popularity: 9
No. The word IQ is an acronym or short for Intelligence Quotient and is therefore not acceptable. However, QI is an acceptable word (it's a variation of the word "chi" as in "taichi"). Qi: The vital force that in Chinese thought is inherent in all things.
Popularity: 21
ends, Enid, Enna, Ents, envy
Popularity: 7
sympathy, abjectly, abruptly, absurdly, accuracy, acerbity, acridity, acrimony, actively, activity, actually, adequacy, adorably, adroitly, advisory, advocacy, affinity, agronomy, alacrity, aleatory, allegory, alleyway, almighty, amicably, amorally, ancestry, annually, antibody, antimony, apical…
Popularity: 57
three such words are: nihilistic Mississippi Visibility
Popularity: 36
It depends on whether you are talking about Scrabble or Super Scrabble, and what language version of the game you are referring to. The original English game has a letter distribution as follows: A-9 B-2 C-2 D-4 E-12 F-2 G-3 H-2 I-9 J-1 K-1 L-4 M-2 N-6 O-8 P-2 Q-1 R-6 S-4 T-6 U-4 V-2 W-2 X-1 Y-2 Z…
Popularity: 9
jumpyjittery jolly joyous
Popularity: 2
You count up your points. If you lay down a word and none of the letters in your word are on bonus squares, then you count up the points listed on each letter. If there is a bonus square under one of the tiles you placed, then you will do what it says... double the word score or the letter score,…
Popularity: 19
Dictionary They call them dictionarys... dry www.dictionary.com where you can type a definition and find the word that best matches ;) great technology we have ay... wow... dictionarys  Dictionary They call them dictionarys... dry www.dictionary.com where you can type a definition and find…
Popularity: 8
Reasons For Being Late: Alphabetical List A: Adultery Appointment Alarm clock wasn't working Aliens landed in Central Park Arrested Apathy B: Birthday Burglary Because Botox Busted Beer-fest last night Broke your toe/foot C: Cheating on your spouse Car keys were missing Car wouldn't start Cat…
Popularity: 12
fdjhdjfhrjhfjddhkdjamrnfuendjfie hjrn dsmyf udfh uf ufaf rh rj d yes 21 not in english thow http://www.answers.com/qi wait.... .... .... ... ... . . . .... ............................................................................. . . . . .. . . . . ..yes there are some in engl…
Popularity: 15
Democracy!
Popularity: 12
Gemsbok
Popularity: 0
Aha!
Popularity: 0
You may be thinking of a double consonant. A consonant is a letter of the alphabet that is not a vowel. A double consonant is when a word that has two of the same consonant together in the word, such as little or happy, or even Mississippi.
Popularity: 6
Answer Manumission: the act of freeing from slavery.
Popularity: 7
go to http://www.webcogs.com/products/letterscrambler/ and d/l their letter scrambler proggy. put the letters in and hit enter or whatever the button is. viola! you'll have all your words! I use this program to play Word Mojo ! :) [Above is NOT the right answer - you don't just DOWNLOAD the product …
Popularity: 1
Some eight letter words starting with S are:settingsstranglescrolledschooledspoilagesurprisesurgicalshepherdstallionskeletonsaturateshameful
Popularity: 7
Words beginning with X: xamoterolxanax xanthan xanthate xanthation xanthe xantheinxanthelasma xanthenesxanthicxanthide Xanthidia xanthidium xanthin xanthine xanthines xanthinine xanthinuria xanthippe xanthism xanthiumxanthocarpous xanthochroid xanthodont Xanthodontous xanthogenxanthomatous xanthome…
Popularity: 25
I can only find 6 letter words HYDRAS ,STURDY ,SUDARY ,THUYAS ,TRASHY ,YURTAS
Popularity: 1
Answer It is incorrect for Scrabble dictionaries to disallow 'iraqi'. According to Collins (the official Scrabble dictionary)Iraqi is an adjective as well as a proper noun. Adjectives are permitted. It's an anomaly.
Popularity: 31
appleampleardoractoraddle
Popularity: 4
eats, even, each, epee, echo, edge, ease, east, ever, elan
Popularity: 5
easeeelseggsemitendseverevenexamexit
Popularity: 1
Answer crime, brine, slime, motoroil, and idiotic, and stupidity, and most of all redardedness. does that answer your question?
Popularity: 45
well I had that for homework and the only ones I got was microscope, micrometer, microwave and microphone
Popularity: 98
Subbookkeeper (yes, it's a real word!) has four consecutive double letters.
Popularity: 13
· able · ache · acid · acme · acre · aero · afar · ahoy · akin · alma · also · alum · amen · ammo · anew · ante · arch · area · arid · army · atom · aunt · auto · avid · away · axel
Popularity: 0
Apple abdomen absorption animal ace.
Popularity: 1
JELLYS
Popularity: 1
I don't know if this is all of them kid, but it's probably most of them: jajaapjaapsjabjabbedjabberjabberedjabbererjabberersjabberingjabberinglyjabberingsjabbersjabberwockjabberwockiesjabberwocksjabberwockyjabbingjabbinglyjabblejabbledjabblesjabblingjabersjabirujabirusjaborandijaborandisjabotjabotic…
Popularity: 0
The game contains 100 tiles: 98 are each marked with a letter and the point value of that letter and there are 2 blank tiles that can be used as any letter. There are 100 letter tiles.
Popularity: 10
Quill, quiver, quackQueen, quick, Qabballah
Popularity: 17
Answer Rune Inure Rein Ruin Neri Iron Erin That's all I've got time for right now! Answer 'Oi! Urine.'
Popularity: 26
Permutation Hello,That is called a Permutation,it can also be done with number Example. Letter Permutation abc acb bac bca cab cba Numerical Permutation 123 132 213 231 321 312 Are you thinking of an acrostic instead?
Popularity: 12
Depends on the school... there are classes about almost anything, including vocabulary. Ukelele Undertaker Underclothing Uvula Understand Umbrage Uppercut Utah Utilize
Popularity: 1
Aaftaleanateeatelffanfatfatefeatfenfeltflatlealetleanlaneleafnetneattanteatealtaleten
Popularity: 1
xylophone xray Xerxes xerox
Popularity: 2
Answer well, i thought of it really fast and the ones that i got up to was: mob,cob, and bob. those are the ones that are close to that i can get maybe i can think of more and tell you.
Popularity: 12
Words that start with J include: jab jack Jake jail jam jimmy Jane Janet Janey Janice January Janus Japan Japanese java jaw jaws jay jazz jeer jeered jerk jerky Jerry jester jet jet-setting jib jibbing jiff jiffy jig Jill Jim jive jinx jinxed jittery jell jet, jest jesting Jew jewel Jewish Jo job…
Popularity: 0
Answer Gnu. kung fu
Popularity: 27
Kimono. Kilt.Knickers.Kerchief.Knee Socks. kilt Kiltknickerskimonokiltknee socksScattegories? lol. Knit TopKhakis, knit shirt and K-Swiss sneakers are clothing items. Knickers, kimono and a kaftan are clothing items.· kerchief · khakis · kilt · kimono · knee socks · knickers · k…
Popularity: 16
Abercrombie Caves, NSW Adaminaby, NSW Adelaide Hills, SA Adelaide River, NT Adelong, NSW Aireys Inlet, VIC Albany, WA Albury, NSW Aldgate, SA Aldinga, SA Alexandra, VIC Alice Springs, NT Allora, QLD Alpha, QLD Alstonville, NSW Anakie, VIC Andamooka, SA Anglesea, VIC Ansons Bay, TAS…
Popularity: 0
The type of word would be a Gibberish word. Yeah, not enough vowels.
Popularity: 1
THere are 303 words that begin with the letter X.
Popularity: 0
No but they are mostly played in older people clubs.
Popularity: 10
AARGHABASHAHIGHAIRTHAITCHALEPHALMAHALMEHANIGHAPISHARISHARRAHAWASHAZOTHBAITHBANDHBATCHBEACHBEATHBEECHBEKAHBELAHBELCHBENCHBERTHBIMAHBIRCHBIRTHBITCHBLASHBLUSHBOOTHBOTCHBOUGHBRACHBRASHBRITHBROCHBROGHBROTHBRUGHBRUSHBUMPHBUNCHBUNDHBURGHBUTCHCANEHCATCHCHETHCHICHCINCHCLACHCLASHCLOTHCOACHCONCHCOOCHCOUCHCOUGH…
Popularity: 25
redAnswerAll colors have the potential to be dark, as there are ways to remove brightness (by layering black on top, in some cases).Dark colors are colors that are closer to black than to white.
Popularity: 21
No you can't. I feel the brevity of this answer possibly misses the point of the person that asked it. PROPER names are generally not included in the OSPD (Official Scrabble Players Dictionary). HOWEVER, when a word we might usually recognize to be a "people name" has another meaning, it may often …
Popularity: 7
Hawaiian skiing radii fasciitis toriitaxiing
Popularity: 29
kindergarten, kind, king, kinesthetic, kin, kiss, kick, knock, knee, know, kinit, knife, kneel, kitchen
Popularity: 0
abaca. abaya. aboma. aceta. adyta. aecia. agama. agita. agora. agria. ajiva. ajuga. akela. aliya. aloha. alpha. alula. ameba. amiga. amnia. anima. antra. aorta. apnea. areca. arepa. aroma. asana. asyla. atria.* arena
Popularity: 2
4-letter words adze, azan, azon, bize, bozo, buzz, chez, cozy, czar, daze, doze, dozy, faze, fizz, fozy, friz, futz, fuze, fuzz, gaze, haze, hazy, izar, jazz, jeez, laze, lazy, maze, mazy, mozo, nazi, ooze, oozy, orzo, ouzo, oyez, phiz, prez, putz, quiz, raze, razz, ritz, size, sizy, spaz, tzar, whi…
Popularity: 0
The word is "oatmeal."
Popularity: 0
Q
Popularity: 0
Jumping
Popularity: 3
alerotrolelielinelaneraillonelonerotterononeanatlatelatertannertantorntrailtraittrainloiternoteranlattertoiltailtaletonneton There are more but these are all I can think of off-hand.
Popularity: 9
agile, brave, crave, drive, elude, froze, grave, heave, inure, juice, knife, louse, mouse, noose, obese, prose, quite, rouse, souse, those, uncle, value, while, you're
Popularity: 36
demo mends ton stem tons nod nods net ten demos mend eds... and many moree
Popularity: 0
Successfully. Heedlessness Committeeman Committeemen
Popularity: 4
gnu / milieu / you / Peru / adieu
Popularity: 3
· quack · quaint · qualified · quality · quarrelsome · quarterly · questionable · quick · quickest · quiet · quirky · quixotic · quizzical · quarrel · quarter · quartz · queen · question · quicksand · quiet · quill · quilt · quiver · quiz
Popularity: 3
AbacaAbakaAbayaAbomaAcetaAdytaAeciaAgamaAgitaAgoraAgriaAjivaAjugaAkelaAliyaAlohaAlphaAlulaAmebaAmigaAmniaAnimaAntraAortaApneaArecaArenaArepaAromaAsanaAsylaAtriaBabkaBaccaBaizaBalsaBandaBarcaBelgaBettaBiotaBoheaBoylaBravaBrazaBubbaBullaBunyaBurkaBurqaBursaBwanaCaecaCallaCannaCeibaCellaCeriaCestaChela…
Popularity: 1
Answer rays, rams, ribs, rues, rags, raps, rods,
Popularity: 39
Answer El Dorado
Popularity: 9