Share on Facebook Share on Twitter Email
Answers.com

calcitonin

 
(kăl'sĭ-tō'nĭn) pronunciation
n.
A peptide hormone, produced by the thyroid gland in humans, that lowers plasma calcium and phosphate levels without augmenting calcium accretion. Also called thyrocalcitonin.

[CALCI- + TON(E) + -IN.]


Search unanswered questions...
Enter a question here...
Search: All sources Community Q&A Reference topics

Key Terms: Paget's disease.

Definition

Calcitonin is a hormone involved in regulating calcium metabolism. The hormone calcitonin is produced by the thyroid gland. A synthetic human product, sold as Calcimar or Miacalcin, is available in the United States. A third brand called Fortical applied for U.S. Food and Drug Administration (FDA) approval in 2003 for marketing in the United States.

Purpose

Calcitonin is often ordered for cancer patients experiencing bone pain due to metastasis. Calcitonin is also used to treat Paget's disease, post-menopausal osteoporosis, and increased levels of calcium in the blood.

Description

Calcitonin reduces breakdown of bone. It causes less bone tissue to be reabsorbed. It slows the rate of bone destruction and decreases the amount of calcium released into the blood. Most calcitonin ordered for patients is derived from salmon. Calcitonin is not effective when given orally, and is available for injection or in a nasal spray.

Recommended Dosage

The usual dose for patients receiving calcitonin-salmon for bone metastases is 200 IU given through the vein twice daily. It is important to take this drug exactly as ordered. If a dose is missed and is noticed within two hours, the drug should be taken. If it is not noted until later, the patient should skip the dose and return to the regular schedule. Patients should not take additional or double doses. When using calcitonin to lower calcium levels, therapy is limited to approximately five days. Extended use of calcitonin results in a loss of calcium-lowering effect.

Precautions

Calcitonin-salmon solution should be stored in the refrigerator, not frozen. Patients should allow a new bottle of nasal spray to warm to room temperature. It may be kept at room temperature for two to four weeks. The nasal spray pump should be primed before using. Patients should push the plunger until a mist is observed, usually within several pushes. Before using, the patient should blow his or her nose. The patient should alternate nostrils with each dose. The head should be kept upright. The pump should be pressed toward the bottle one time. The patient should not inhale when spraying. The patient should then inhale through the nose and exhale through the mouth. The nosepiece should be wiped clean after each use. Patients giving themselves an injection should check that the contents are clear. Patients should not inject medication that is colored or grainy.

Calcitonin should be used cautiously when breast feeding, as it may decrease the amount of available milk. Its use during pregnancy has not been adequately studied. However, animal studies indicated a risk for low birth weight offspring.

Side Effects

Calcitonin is a protein. It may cause a severe allergic reaction. The doctor should be notified if a rash or hives develop. Patients should have supplies on hand to manage an allergic reaction. Skin testing may be done prior to treatment. Allergic reactions are rarer in the human product than in the salmon product.

Diarrhea, red skin, poor appetite, nausea, vomiting, stomach pain, and back and joint pain are common side effects. Other side effects include increased or decreased appetite, gas, constipation, or an unusual taste in the mouth. Nausea is usually mild and temporary. Giving calcitonin at bedtime may decrease nausea and vomiting. Patients may experience dizziness, difficulty sleeping, anxiety, headache, agitation, palpitations, or other heart problems. Redness, swelling and soreness may occur at the injection site. Patients using the nasal spray may develop crusting or patches in the nose, as well as nasal dryness, redness, swelling or irritation. Less often, those using the nasal spray may experience difficulty with urination, breathing problems, loss of smell, or cold symptoms. Some patients injecting the drug may develop frequent urination, chills, dizziness, headache, chest pressure, a congested nose, tingling or discomfort in the hands and feet, difficulty breathing or weakness. Patients should notify the doctor if side effects occur. Side effects may subside as the patient's body becomes accustomed to the drug. Patients should receive regular medical checks and lab work to assess for adverse reactions and changes in urine content.

Interactions

At present, there are no known interactions with other drugs.

Resources

Periodicals

Boersig, Charles."Nasal Calcitonin in Greece." Med Ad News November 2003: 14.

—Debra Wood, R.N.; Teresa G. Odle

Drug Info:

Calcitonin

Top

Brand names: Fortical®, Miacalcin®

Chemical formula:



Calcitonin injection

What is calcitonin injection?

CALCITONIN (Miacalcin®) controls the amount of calcium in your body and helps maintain proper bone density. Calcitonin is used to treat diseases of the bone such as Paget's disease and osteoporosis. Calcitonin is used to treat excess amounts of calcium in the blood. Generic calcitonin injection is available.

What should I tell my health care provider before I take this medicine?

They need to know if you have any of these conditions:
• low level of blood calcium
• an unusual or allergic reaction to calcitonin, fish, other medicines, foods, dyes, or preservatives
• pregnant or trying to get pregnant
• breast-feeding

How should I use this medicine?

Calcitonin is for injection into a muscle or under the skin. If you have been instructed to give yourself calcitonin injections, make sure that you understand how to prepare and inject the dose. Use exactly as directed. Do not exceed the prescribed dose, and do not use more or less often than prescribed.

Contact your pediatrician or health care professional regarding the use of this medicine in children. Special care may be needed.

What if I miss a dose?

If you use two doses per day, give the missed dose only if you remember within 2 hours. Otherwise, skip the dose and resume your regular schedule with the next dose. Do not use double doses.

If you use one dose per day, give the missed dose as soon as you remember on the day the dose was due. If you do not remember until the next day, skip the dose and resume your regular schedule with the next dose. Do not use double doses.

If you use one dose every other day, give the missed dose as soon as you remember on the day the dose was due. If you do not remember until the next day, use the dose and skip a day to resume an every-other-day schedule. Do not use double doses.

If you use three doses per week (Monday, Wednesday, Friday), give the missed dose as soon as you remember on the day the dose was due. If you do not remember until the next day, give the missed dose and give the rest of the doses a day later than normal. Do not use double doses or use doses two days in a row. Return to your regular schedule the following week.

What drug(s) may interact with calcitonin?

lithium

Tell your prescriber or health care professional about all other medicines you are taking, including non-prescription medicines, nutritional supplements, or herbal products. Also tell your prescriber or health care professional if you are a frequent user of drinks with caffeine or alcohol, if you smoke, or if you use illegal drugs. These may affect the way your medicine works. Check with your health care professional before stopping or starting any of your medicines.

What should I watch for while taking calcitonin?

Visit your prescriber or health care professional for regular checks on your progress. Calcitonin can make your blood calcium level dangerously low. You will need regular blood tests while using calcitonin. Ask your prescriber or health care professional about calcium in your diet.

You may also need to take supplements of calcium and vitamin D while you are receiving calcitonin, unless you are being treated for high calcium levels. Discuss whether calcium and vitamin D supplements are right for you with your prescriber or health care provider.

Store needles and syringes out of the reach of children. Make sure you receive a puncture-resistant container to dispose of the needles and syringes once you have finished with them. Do not reuse these items. Return the container to your prescriber or health care professional for proper disposal.

What side effects may I notice from receiving calcitonin?

Side effects that you should report to your prescriber or health care professional as soon as possible:
• chest pain, fast or irregular heartbeat (palpitations)
• difficulty breathing, wheezing
• dizziness
• fever, chills
• rash or itching (hives)
• swelling of the tongue, difficulty swallowing
• tingling in the hands or feet

Side effects that usually do not require medical attention (report to your prescriber or health care professional if they continue or are bothersome):
• diarrhea
• flushing (reddening of the face, ears, or hands)
• headache
• heartburn
• loss of appetite
• nausea, vomiting
• pain, redness, irritation or swelling at the injection site
• stomach pain

Where can I keep my medicine?

Keep out of the reach of children.

Store in a refrigerator between 2—8 degrees C (36—46 degrees F); do not freeze. Throw away any unused medicine after the expiration date.


Last updated: 7/1/2002

Important Disclaimer: The drug information provided here is for educational purposes only. It is intended to supplement, not substitute for, the diagnosis, treatment and advice of a medical professional. This drug information does not cover all possible uses, precautions, side effects and interactions. It should not be construed to indicate that this or any drug is safe for you. Consult your medical professional for guidance before using any prescription or over the counter drugs.


(salmon)

A synthetic or genetically engineered form of calcitonin, a hormone secreted by the thyroid gland that lowers circulating concentrations of calcium by promoting the uptake of calcium into bone. It is used to reduce abnormally high concentrations of calcium in the blood, especially in people with cancer, to relieve pain in Paget's disease (in which the bones become deformed and fracture easily), and to reduce the risk of spinal fractures in the treatment and prevention of osteoporosis in postmenopausal women. Calcitonin (salmon) is available as an injection or nasal spray on prescription only.

Side effects:
include nausea, vomiting, and flushing (which diminish with use); the nasal spray may cause nose and throat irritation. Less common side effects are tingling of hands, an unpleasant taste, rash, and inflammation at the injection site.

Precautions:
some people are allergic to calcitonin (salmon) and a scratch test may be necessary before taking the drug. It should be used with caution in women who are pregnant or breastfeeding.

Proprietary preparation:
Miacalcic.

Previous:calcipotriol, calciferol, calamine
Next:calcitriol, calcium, calcium acetate

A polypeptide hormone secreted by the thyroid gland which is a major regulator of calcium ion concentration in the blood of children. It inhibits bone degradation and stimulates the uptake of calcium and phosphate by bone.

Word Tutor:

thyrocalcitonin

Top
pronunciation

IN BRIEF: n. - Hormone that tends to lower the level of a particular mineral in the blood plasma and inhibit resorption of bone.

LearnThatWord.com is a free vocabulary and spelling program where you only pay for results!

or thyrocalcitonin

a 3.4 kDa polypeptide hormone that regulates the levels of calcium and phosphate in blood. In all species studied it consists of a single polypeptide chain of 32 amino-acid residues with a C-terminal prolinamide residue and an N-terminal seven-membered ring formed by a disulfide bridge between hemicystine residues at positions 1 and 7. The single letter code structure for the polypeptide is
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP — NH2
. Calcitonin is secreted by the C cells, which in mammals occur primarily in the thyroid gland; in more primitive vertebrates they are found mainly in the ultimobranchial bodies and the lung. The hormone is concentrated in the hypothalamus of humans and some other vertebrates, and in the prim itive brain of the chordate organism Ciona intestinalis. Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting their incorporation in the bones. Overall its action is antihypercalcemic, opposing that of parathyrin. The response of plasma calcitonin to stimulation by administered pentagastrin or calcium may be used to screen for medullary cell carcinoma of the thyroid; the level rises to abnormally high values after stimulation, though normal in its absence. The precursor (locus at 11p15.2-p15.1) also contains katacalcin. Both the calcitonin precursor and calcitonin gene-related peptide precursor are formed by alternative splicing of the same gene.

Previous:calcitetrol, calciphorin, calciotropic
Next:calcitonin gene-related peptide, calcitonin gene-related peptide receptor, calcitonin receptor

A polypeptide hormone secreted by the parafollicular or C cells of the thyroid gland, which is involved in plasma calcium homeostasis. It acts to decrease the rate of bone resorption. Called also thyrocalcitonin.

  • c. gene-related peptides — potent vasodilators widely distributed in periadventitial nerves of blood vessels, sinoatrial and atrioventricular nodes, sensory neurons and the central nervous system generally.
  • c.-secreting cells — parafollicular cells of the thyroid gland.

n

trade names: Calcitonin, Calcimar, Miacalcin; drug class: synthetic polypeptide calcitonins; action: inhibits bone resorption, reduces osteoclast function, reduces serum calcium levels in hypercalcemia; uses: Paget’s disease, postmenopausal osteoporosis, hypercalcemia.

Random House Word Menu:

categories related to 'calcitonin'

Top
Random House Word Menu by Stephen Glazier
For a list of words related to calcitonin, see:
  • Physiology - calcitonin: peptide hormone secreted by thyroid that reduces excess of calcium in blood by depositing it in bone


Wikipedia on Answers.com:

Calcitonin

Top
Calcitonin/calcitonin-related polypeptide, alpha

NMR solution structure of salmon calcitonin in SDS micelles.[1]
Identifiers
Symbols CALCA; CALC1; CGRP; CGRP-I; CGRP1; CT; KC; MGC126648
External IDs OMIM114130 MGI2151253 HomoloGene1319 GeneCards: CALCA Gene
RNA expression pattern
PBB GE CALCA 210728 s at tn.png
PBB GE CALCA 210727 at tn.png
PBB GE CALCA 217495 x at tn.png
More reference expression data
Orthologs
Species Human Mouse
Entrez 796 12310
Ensembl ENSG00000110680 ENSMUSG00000030669
UniProt P01258 Q99JA0
RefSeq (mRNA) NM_001033952 NM_001033954
RefSeq (protein) NP_001029124 NP_001029126
Location (UCSC) Chr 11:
14.94 – 14.95 Mb
Chr 7:
114.42 – 114.43 Mb
PubMed search [1] [2]

Calcitonin is a 32-amino acid linear polypeptide hormone that is produced in humans primarily by the parafollicular cells (also known as C-cells) of the thyroid, and in many other animals in the ultimobranchial body.[2] It acts to reduce blood calcium (Ca2+), opposing the effects of parathyroid hormone (PTH).[3] Calcitonin has been found in fish, reptiles, birds, and mammals. Its importance in humans has not been as well established as its importance in other animals, as its function is usually not significant in the regulation of normal calcium homeostasis.[4]. It belongs to calcitonin-like protein family.

Contents

Biosynthesis and regulation

Calcitonin is formed by the proteolytic cleavage of a larger prepropeptide, which is the product of the CALC1 gene (CALCA). The CALC1 gene belongs to a superfamily of related protein hormone precursors including islet amyloid precursor protein, calcitonin gene-related peptide, and the precursor of adrenomedullin.

Secretion of calcitonin is stimulated by:

Effects

The hormone participates in calcium (Ca2+) and phosphorus metabolism. In many ways, calcitonin counteracts parathyroid hormone (PTH).

More specifically, calcitonin lowers blood Ca2+ levels in three ways:

In its skeleton-preserving actions, calcitonin protects against calcium loss from skeleton during periods of calcium mobilization, such as pregnancy and, especially, lactation

While calcitonin is the antipode of parathyroid hormone (PTH) in those actions, it is not dissimilar from PTH in its effect on electrolyte reabsorption in the kidneys. Namely, calcitonin:

  • Inhibits phosphate reabsorption by the kidney tubules[10]
  • Calcitonin decreases tubular reabsorption of Ca2+, leading to increased rates of its loss in urine.[11]

Other effects are in preventing postprandial hypercalcemia resulting from absorption of Ca2+. Also, calcitonin inhibits food intake in rats and monkeys, and may have CNS action involving the regulation of feeding and appetite.

Receptor

The calcitonin receptor, found on osteoclasts,[12] and in kidney and regions of the brain, is a G protein-coupled receptor, which is coupled by Gs to adenylate cyclase and thereby to the generation of cAMP in target cells. It may also affect the ovaries in women and the testes in men.

Discovery

Calcitonin was purified in 1962 by Copp and Cheney.[13] While it was initially considered a secretion of the parathyroid glands, it was later identified as the secretion of the C-cells of the thyroid gland.[14]

Pharmacology

Salmon calcitonin is used for the treatment of:

It has been investigated as a possible non-operative treatment for spinal stenosis.[16]

The following information is from the UK Electronic Medicines Compendium[17]

General characteristics of the active substance

Salmon calcitonin is rapidly absorbed and eliminated. Peak plasma concentrations are attained within the first hour of administration.

Animal studies have shown that calcitonin is primarily metabolised via proteolysis in the kidney following parenteral administration. The metabolites lack the specific biological activity of calcitonin. Bioavailability following subcutaneous and intramuscular injection in humans is high and similar for the two routes of administration (71% and 66%, respectively).

Calcitonin has short absorption and elimination half-lives of 10–15 minutes and 50–80 minutes, respectively. Salmon calcitonin is primarily and almost exclusively degraded in the kidneys, forming pharmacologically-inactive fragments of the molecule. Therefore, the metabolic clearance is much lower in patients with end-stage renal failure than in healthy subjects. However, the clinical relevance of this finding is not known. Plasma protein binding is 30% to 40%.

Characteristics in patients

There is a relationship between the subcutaneous dose of calcitonin and peak plasma concentrations. Following parenteral administration of 100 IU calcitonin, peak plasma concentration lies between about 200 and 400 pg/ml. Higher blood levels may be associated with increased incidence of nausea and vomiting.

Preclinical safety data

Conventional long-term toxicity, reproduction, mutagenicity, and carcinogenicity studies have been performed in laboratory animals. Salmon calcitonin is devoid of embryotoxic, teratogenic, and mutagenic potential.

An increased incidence of pituitary adenomas has been reported in rats given synthetic salmon calcitonin for 1 year. This is considered a species-specific effect and of no clinical relevance.[citation needed] Salmon calcitonin does not cross the placental barrier.

In lactating animals given calcitonin, suppression of milk production has been observed. Calcitonin is secreted into the milk.

Pharmaceutical manufacture

Calcitonin was extracted from the Ultimobranchial glands (thyroid-like glands) of fish, particularly salmon. Salmon calcitonin resembles human calcitonin, but is more active. At present, it is produced either by recombinant DNA technology or by chemical peptide synthesis. The pharmacological properties of the synthetic and recombinant peptides have been demonstrated to be qualitatively and quantitatively equivalent.[17]

Uses of calcitonin

Treatments

Calcitonin can be used therapeutically for the treatment of hypercalcemia or osteoporosis.

Oral calcitonin may have a chondroprotective role in osteoarthritis (OA), according to data in rats presented in December, 2005, at the 10th World Congress of the Osteoarthritis Research Society International (OARSI) in Boston, Massachusetts. Although calcitonin is a known antiresorptive agent, its disease-modifying effects on chondrocytes and cartilage metabolisms have not been well established until now.

This new study, however, may help to explain how calcitonin affects osteoarthritis. “Calcitonin acts both directly on osteoclasts, resulting in inhibition of bone resorption and following attenuation of subchondral bone turnover, and directly on chondrocytes, attenuating cartilage degradation and stimulating cartilage formation,” says researcher Morten Karsdal, MSC, PhD, of the department of pharmacology at Nordic Bioscience in Herlev, Denmark. “Therefore, calcitonin may be a future efficacious drug for OA.”[18]

Subcutaneous injections of calcitonin in patients suffering from mania resulted in significant decreases in irritability, euphoria and hyperactivity and hence calcitonin holds promise for treating bipolar disorder.[19] However no further work on this potential application of calcitonin has been reported.

Diagnostics

It may be used diagnostically as a tumor marker for medullary thyroid cancer, in which high calcitonin levels may be present and elevated levels after surgery may indicate recurrence. It may even be used on biopsy samples from suspicious lesions (e.g., swollen lymph nodes) to establish whether they are metastasis of the original cancer.

Cutoffs for calcitonin to distinguish cases with medullary thyroid cancer have been suggested to be as follows, with a higher value increasing the suspicion of medullary thyroid cancer:[20]

  • females: 5 ng/L or pg/mL
  • males: 12 ng/L or pg/mL
  • children under 6 months of age: 40 ng/L or pg/mL
  • children between 6 months and 3 years of age: 15 ng/L or pg/mL

When over 3 years of age, adult cutoffs may be used

Structure

Calcitonin is a polypeptide hormone of 32 amino acids, with a molecular weight of 3454.93 daltons. Its structure comprises a single alpha helix.[1] Alternative splicing of the gene coding for calcitonin produces a distantly related peptide of 37 amino acids, called calcitonin gene-related peptide (CGRP), beta type.[21]

The following are the amino acid sequences of salmon and human calcitonin:[22]

  • salmon: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro
  • human: Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro

Compared to salmon calcitonin, human calcitonin differs at 16 residues.

See also

References

  1. ^ a b PDB 2glhAndreotti G, Méndez BL, Amodeo P, Morelli MA, Nakamuta H, Motta A (August 2006). "Structural determinants of salmon calcitonin bioactivity: the role of the Leu-based amphipathic alpha-helix". J. Biol. Chem. 281 (34): 24193–203. doi:10.1074/jbc.M603528200. PMID 16766525. 
  2. ^ Costoff A. "Sect. 5, Ch. 6: Anatomy, Structure, and Synthesis of Calcitonin (CT)". Endocrinology: hormonal control of calcium and phosphate. Medical College of Georgia. http://www.lib.mcg.edu/edu/eshuphysio/program/section5/5ch6/s5ch6_21.htm. Retrieved 2008-08-07. 
  3. ^ Boron WF, Boulpaep EL (2004). "Endocrine system chapter". Medical Physiology: A Cellular And Molecular Approach. Elsevier/Saunders. ISBN 1-4160-2328-3. 
  4. ^ Costoff A. "Sect. 5, Ch. 6: Biological Actions of CT". Medical College of Georgia. http://www.lib.mcg.edu/edu/eshuphysio/program/section5/5ch6/s5ch6_23.htm. Retrieved 2008-08-07. 
  5. ^ Costanzo, Linda S. (2007). BRS Physiology. Lippincott, Williams, & Wilkins. pp. 263. ISBN 978-0781773119. http://www.amazon.com/Physiology-Board-Review-Linda-Costanzo/dp/0781773113/. 
  6. ^ Erdogan MF, Gursoy A, Kulaksizoglu M (October 2006). "Long-term effects of elevated gastrin levels on calcitonin secretion". J Endocrinol Invest. 29 (9): 771–775. PMID 17114906. http://www.kurtis.it/abs/index.cfm?id_articolo_numero=3037. 
  7. ^ Costoff A. "Sect. 5, Ch. 6: Effects of CT on the Small Intestine". Medical College of Georgia. http://www.lib.mcg.edu/edu/eshuphysio/program/section5/5ch6/s5ch6_26.htm. Retrieved 2008-08-07. 
  8. ^ Costoff A. "Sect. 5, Ch. 6: Effects of CT on Bone". Medical College of Georgia. http://www.lib.mcg.edu/edu/eshuphysio/program/section5/5ch6/s5ch6_24.htm. Retrieved 2008-08-07. 
  9. ^ Potts, John; Jüppner, Harald (2008). "Chapter 353. Disorders of the Parathyroid Gland and Calcium Homeostasis". In Dan L. Longo, Dennis L. Kasper, J. Larry Jameson, Anthony S. Fauci, Stephen L. Hauser, and Joseph Loscalzo. Harrison's Principles of Internal Medicine (18 ed.). McGraw-Hill. 
  10. ^ Carney SL (1997). "Calcitonin and human renal calcium and electrolyte transport". Miner Electrolyte Metab 23 (1): 43–7. PMID 9058369. 
  11. ^ Rhoades, Rodney (2009). Medical Physiology: Principles for Clinical Medicine. Philadelphia: Lippincott Williams & Wilkins. ISBN isbn-13: 978-0-7817-6852-8. 
  12. ^ Nicholson GC, Moseley JM, Sexton PM, et al (1986). "Abundant calcitonin receptors in isolated rat osteoclasts. Biochemical and autoradiographic characterization". J Clin Invest 78 (2): 355–60. doi:10.1172/JCI112584. PMC 423551. PMID 3016026. http://www.pubmedcentral.nih.gov/articlerender.fcgi?tool=pmcentrez&artid=423551. 
  13. ^ Copp DH, Cheney B (January 1962). "Calcitonin-a hormone from the parathyroid which lowers the calcium-level of the blood". Nature 193 (4813): 381–2. doi:10.1038/193381a0. PMID 13881213. 
  14. ^ Hirsch PF, Gauthier GF, Munson PL (august 1963). "Thyroid hypocalcemic principle and recurrent laryngeal nerve injury as factors affecting the response to parathyroidectomy in rats". Endocrinology 73 (2): 244–252. doi:10.1210/endo-73-2-244. PMID 14076205. 
  15. ^ Wall GC, Heyneman CA (April 1999). "Calcitonin in phantom limb pain". Ann Pharmacother 33 (4): 499–501. doi:10.1345/aph.18204. PMID 10332543. 
  16. ^ Tran de QH, Duong S, Finlayson RJ (July 2010). "Lumbar spinal stenosis: a brief review of the nonsurgical management". Can J Anaesth 57 (7): 694–703. doi:10.1007/s12630-010-9315-3. PMID 20428988. 
  17. ^ a b "Electronic Medicines Compendium". http://emc.medicines.org.uk/. Retrieved 2008-08-07. 
  18. ^ Kleinman DM (2006-01-04). "Oral Calcitonin May Delay Onset of Joint Disease and Relieve Pain of OA". Musculoskeletal Report. Musculoskeletal Report, LLC. http://www.mskreport.com/articles.cfm?ArticleID=515. Retrieved 2008-08-07. 
  19. ^ Vik A, Yatham LN (March 1998). "Calcitonin and bipolar disorder: a hypothesis revisited". J Psychiatry Neurosci 23 (2): 109–17. PMC 1188909. PMID 9549251. http://www.pubmedcentral.nih.gov/articlerender.fcgi?tool=pmcentrez&artid=1188909. 
  20. ^ Basuyau, J. -P.; Mallet, E.; Leroy, M.; Brunelle, P. (2004). "Reference Intervals for Serum Calcitonin in Men, Women, and Children". Clinical Chemistry 50 (10): 1828–1830. doi:10.1373/clinchem.2003.026963. PMID 15388660.  edit
  21. ^ "calcitonin domain annotation". SMART (a Simple Modular Architecture Research Tool). embl-heidelberg.de. http://smart.embl-heidelberg.de/smart/do_annotation.pl?BLAST=DUMMY&DOMAIN=SM00113. Retrieved 2009-02-22. 
  22. ^ http://www.newworldencyclopedia.org/entry/Calcitonin

Further reading

External links


 
 

 

Copyrights:

American Heritage Dictionary. The American Heritage® Dictionary of the English Language, Fourth Edition Copyright © 2007, 2000 by Houghton Mifflin Company. Updated in 2009. Published by Houghton Mifflin Company. All rights reserved.  Read more
$copyright.smallImage.alttext Gale Encyclopedia of Cancer. Gale Encyclopedia of Cancer. Copyright © 2006 by The Gale Group, Inc. All rights reserved.  Read more
Drug Info. Gold Standard. Copyright © 2008 by Gold Standard. All rights reserved.  Read more
 Oxford A-Z of Medicinal Drugs. Market University Press. © 2000, 2003, 2010 An A-Z of Medicinal Drugs. All rights reserved.  Read more
Oxford Dictionary of Sports Science & Medicine. The Oxford Dictionary of Sports Science & Medicine. Copyright © Michael Kent 1998, 2006, 2007. All rights reserved.  Read more
Word Tutor. Copyright © 2004-present by eSpindle Learning, a 501(c) nonprofit organization. All rights reserved.
eSpindle provides personalized spelling and vocabulary tutoring online; sign up free Read more
 Oxford Dictionary of Biochemistry. Oxford University Press. Oxford Dictionary of Biochemistry and Molecular Biology © 1997, 2000, 2006 All rights reserved.  Read more
Saunders Veterinary Dictionary. Saunders Comprehensive Veterinary Dictionary 3rd Edition. Copyright © 2007 by D.C. Blood, V.P. Studdert and C.C. Gay, Elsevier. All rights reserved.  Read more
Mosby's Dental Dictionary. Mosby's Dental Dictionary. Copyright © 2004 by Elsevier, Inc. All rights reserved.  Read more
Random House Word Menu. © 2010 Write Brothers Inc. Word Menu is a registered trademark of the Estate of Stephen Glazier. Write Brothers Inc. All rights reserved.  Read more
Wikipedia on Answers.com. This article is licensed under the Creative Commons Attribution/Share-Alike License. It uses material from the Wikipedia article Calcitonin Read more

Follow us
Facebook Twitter
YouTube