0
What else can I help you with?
Related Questions
Another word for hit 3rd letter must be the letter i?
swipeclip
Another word for finished 3rd letter is r and the 5th letter is I?
Terminated.
What is another word for stats that has 7 letters in it and begins with the letter A and has the letter S the 3rd from the last of the word?
assists
What is another word for fast with 7 letters and 3rd letter is r?
hurried
What is another word for A high shrill sound with 7 letters 3rd letter is i and 5th letter is t?
The word you are looking for is "squeak."
4 letter word with 3rd letter of the word is I?
this
What is a 10 letter word with the letter q as the 3rd letter in the word?
inquisitor
What word has 3rd letter you and 6th letter a?
nausea
Four letter word with A as the 3rd letter?
beatbeadbeanboatbranbragbratbearclancrabdeardealfoamfoalgoatgeargoalhearhealleafleanloadleapleadmoatmealmeanopalplanrealreadreapsoapsoakswapsealtealmeatpealpearrearvealwean
What is a 6 letter word with 3rd letter e?
Beetle is a 6 letter word that has 'e' as the third letter.
What is an 8 letter word with the 3rd letter d?
badinage
What word has 3rd letter u and 6th letter a?
abundancebluejayscrucialdrunkardsequivalentfoundationiguanajournalslaughablemountainsneutralizerhumbasourballstournamentunusual
Trending Questions
How many times does 17 go into 81?
Is 2pac making a comeback in 2014?
What is 7 cubed in expanded form?
What are some examples of irony analogy and oxymoron in Literature?
What happens when you beat the werewolf quests on adventure quest?
The westernmost prairie province is?
What are seven organic compounds manufactured within cytoplasm?
Is there caffeine in green tea?
Is 536 cm bigger or 53.6?
How do you change team size in quake live matches?
How do you disassemble Smith and Wesson model 915?
How do you pass ccie?
What enzyme in the human body is used to repel an invading virus?
How many cents an acre did the US purchase Alaska for?
What do you add to acid to make a mix of salt carbon dioxide and water?
Who sings the rap walk that walk?
What does friar warning these vioent delights violent ends?
Divide the roman numeral dxxii by iii in roman numerals what would be your answer?
How can you release the sliding door lock on your Toyota Sienna so it will close?
Who is the actor playing Santa in the reddi whip commercial?
Copyright ©2026 Infospace Holdings LLC, A System1 Company. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.