Tags Rhyming Words

Animals & Plants Arts & Entertainment Auto Beauty & Health Books and Literature Business Electronics Engineering & Technology Food & Drink History Hobbies Jobs & Education Law & Government Math People & Society Science Social Studies Sports Travel & Places

0

How many words rhyme without?

Wiki User

∙ 12y ago

Best Answer

many like spout,mouth,cloud...

Answer

Spout

Lout

Grout

Gout

Rout

Bout

About

Flout

Devout

Trout

Surtout (a type of jacket or waistcoat)

Clout

Doubt

Umlaut

I disagree with the above: mouth and cloud do not rhyme with out. The ending has to be the sound of OUT or OWT, or AUT in umlaut.

Wiki User

∙ 12y ago

This answer is:

Add your answer:

Earn +20 pts

Q: How many words rhyme without?

Write your answer...

Submit

Still have questions?

imp

Related questions

How many words rhyme with yule?

30 words rhyme with yule.Some words that rhyme with yule:CoolCruelDroolDuelFerruleFeruleFoolFuelGhoulJewelMinisculeMinusculeMisruleMoleculeMuleOverrulePlayschoolPoolPuleRetoolRidiculeRuleSchoolSpoolStoolToolTulleUncoolVestibuleYou'll

How many words rhyme with zoo?

There are 618 words and phrases that rhyme with zoo.

How many words rhyme with lower?

There are 29 words and phrases that rhyme with lower.

How many words rhyme with hop?

AtopBopChopClopCopCropDollopDropFlopGlopLopMaintopMopNonstopPlopPopPropSopShopShoppeSlopStopStropSwapTopWop

How many words can you rhyme with pig?

There are several words that rhyme with "pig," such as big, wig, jigg, and dig.

How many words rhyme with bat?

There is probably an unlimited amount of words but if you try to rhyme words with -at itself it would more-likely rhyme with the base word bat. Hope I helped you :)

Does in rhyme with out?

No. The word "in" does not rhyme with out.Examples of words that rhyme with out:AboutBoutCloutDoubtFloutGoutGroutLoutPoutRoutShoutSnoutStoutToutTroutExamples of words that rhyme with in:BinDinFinGinHenMenSinTenTinWhenWenWinYenYinZen

How many words rhyme with school?

a lot. Trust me.

What words rhyme with gays?

Words that Rhyme with gays:baysblazebraiseclaysdaysdazeflaysglazegreysgrazehazejayslaysmazemaizeMaysneighsnayspaysphraseplayspraysraysslaysspaysspraysstaysstraystazetrayswaysWaze

Words that rhyme with ship?

chipdipdripflipgripgyphiplipnippipripskipslipsnipstriptiptripwhip

How many rhyming words that rhymes with Alone in the Nets?

There are no words that rhyme with both "alone" and "nets" simultaneously. However, you can find words that rhyme with "alone" and others that rhyme with "nets" independently.

What rhymes with magnification?

Many words rhyme with Magnifications. Some words that rhyme with Magnification are - Molestation , Concentration, starvation, gratification, music station, variation,

Trending Questions

What is a senior mode on a cell phone? Definition of cold water current? How long does ibuprofen hold its full potency? Who pushed for the creation of the assembly a. the Caesars c. the Patricians b. the Plebians d. the army? What information in DNA coded in the order of amino acid along one side of the DNA molecule? Where are hoover washer driers made? Who made jack wills clothing? What does global offer mean? Technical jargon everyday term common term in computer? Is sprout on ub funkeys is a girl? What part of speech is the word Marinate? Why are special clothes worn by some people for their work? What aircraft instrument is nicknamed the artificial horizon? How many feet on Millipede? Match roles of the below personnel with their filling resonsiblities? What do people do when it is a full moon? What transportation did the Apache have? What is the best burner phone? Nautical miles between deltaville Virginia and Solomons Maryland? How do you say garlic bread in spanish?

Still have questions?

imp

Previously Viewed

How many words rhyme without?

Resources

Top Categories

Product

Company

Copyright ©2024 Infospace Holdings LLC, A System1 Company. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.