0
In nutrition what is an important means of maintaining your health?
Wiki User
∙ 8y ago
Eat a balanced diet.
Wiki User
∙ 8y ago
Add your answer:
Earn +20 pts
Why is malnutrition important?
Malnutrition is bad. That means not getting the nutrition needed to survive which causes health problems like anorexia.
How are health safety and nutrition interrelated and dependent on one another?
Depends on which kind of nutrition. There are normal nutrition, and high level nutrition, which means correct nutrition. Nutrition also involves right time, spacing of meals, quantity and mainly, quality. They are interrelated, however, nutrition is not the unique item when we're talking about health. You are what you think. And positive thoughts play an important role on your health. Enough sleeping time, reasonable bedtime. Worries are harmful. They trigger fears. And fears trigger worries. Join high level nutrition and positve thoughts, and you'll be walking on a smooth way.
Nutrition is Essential for a Healthy Lifestyle?
A healthy lifestyle consists of factors such as exercise, food intake, and nutrition. Nutrition is important because the body will become malnourished if it doesn't receive essential nutrients. Vitamins can be taken daily to ensure proper nutrition. The most important aspect to nutrition healthy is avoiding excessive carbohydrate intake and fats. Eating a balanced diet means paying attention to iron, protein, and vitamins. Checking the food labels for these ingredients can help determine daily intake. Milk is an excellent source of calcium, which is good for building strong bones. Nutrition is just as important as exercise in maintaining a healthy body.
Why is malnutrition?
Malnutrition is bad. That means not getting the nutrition needed to survive which causes health problems like anorexia.
What does health and safety knowledge mean?
"Health and safety knowledge" means information, and skills that relate to preserving or maintaining people free of illness, injury, etc.
How does sports benefits our academic skills?
They really don't, though sports DO serve an important role in maintaining the health of participants, as well as providing an excellent means for them to learn how to cheat and not get caught (since winning is what counts).
What are the three basic elements of good nutrition?
The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater
What is the meaning of the nutrition?
good nutrition means to eat at right meal time and maintain those foods or diet that are of great health importance and also balanced,which means that ones meal must contain all the classes of food in the right proportion.
1why is nutrition especially important for the teens years?
This is because they are growing which means their body needs more energy.
Explain what ''health is wealth' means?
you are lucky to have health, it is wonderful thing and is more important to happiness than money
What is the importance of proper nutrition that eradicates malnutrition?
Malnutrition means "bad nutrition", which can be corrected by proper nutrition.
What do you mean by a well-balanced diet?
A balanced diet means getting the right types and amounts of foods and drinks to supply nutrition and energy for maintaining body cells, tissues, and organs, and for supporting normal growth and development. A well-balanced diet provides enough energy and nutrition for optimal growth and development.
