How are Canada and Australia similar?
they are simmilar because they both have an A in their names
What country names have 8 letters starting with g?
There are no countries containing only 8 letters and beginning with the letter g.
What country has 6 letters and the third letter is t?
There are actually two (2) countries whose names have 6 letters and the third letter is a "t": Qatar and Latvia.
Which countries have only three letters in their names?
There are no countries with only three letters in their names, but there are 3-letter codes that are used for various purposes. For example, the United Nations has 3-letter country codes and so does the Olympics. For more information about their codes visit the Related Links.
Countries that begin ron?
There are no country names (in English) that begin with the letters 'ron'. The only country that starts with 'ro' is Romania.
What are countries ending with the letters IN?
The country names Bahrain (west Asia) and Benin (Africa) end in IN.
Which countries have only five letters in their names with an S as the second letter?
There are no countries (in English) with names five letters long with "s" as the second letter.
Which country has the longest name?
The longest country names in English = The United Kingdom Of Great Britain And Northern Ireland (48 Letters) The Former Yugoslav Republic of Macedonia (36 Letters) Saint Vincent and the Grenadines (28 Letters) Democratic Republic of the Congo (28 Letters) Federated States of Micronesia (27 Letters) People's Republic of China (22 Letters) United States of America (21 Letters) Bosnia and Herzegovina (20 Letters) However in other languages, some countries have longer names: Thailand =Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.
What are countries ending with the letters CO?
For English names, the country Mexico and Morocco and the principality (city-state) of Monaco.
What does last 3 letters of the word PAKISTAN signified?
It is actually the last four letters who signify a meaning. The suffix -stan is used in multiple country names and it is Persian for "Land of"
Which country or state claims the world's smallest title?
Chad, Cuba, Laos, Mali, Oman, Peru, and Togo all have four letters: the shortest country names.
Graph showing 16 names median length of 14 and a half letters with data that vary from 11 letters to 20 letters?
7 names with 14 names in the median
What animal names have three letters and begin with the letter A?
Animals with three letters that begin with the letter A are; ant ape asp (snake).
What are the names of famous people whose name has 5 letters?
Some famous people with five letter names are Oprah Winfrey, Kanye West, and Tiger Woods. Many people have names with five letters, president Barack Obama's last name has just five letters.
What are the Indian Baby Boy Names starting with letter M?
Please give me Indian names starting with letters Me
What does this mean 24 names that vary from 6 letters to 18 letters?
24 different names that can be spelled with from as little as 6 to as many as 18 letters
What are girls names that are ten letters long?
Alexandria, Antoinette and Jacqueline are girl names. They contain 10 letters.
What countries have eight-letter names?
Barbados and Botswana have 8 letters in their name. Colombia and Malaysia have 8 letters in their name.
What countries have nine letters in their names?
There are several countries with nine letters in their names. Some include Australia, Argentina, and Greenland.
From what three-letter names of common nouns can you take away two letters and still have the same names left?
The names of certain letters of the alphabet such as "bee" "dee" "zee". Remove the double e from each of them and you get b, d, z.
What is uppercase latter?
An "uppercase" letter is also called a "capital" letter. These are the letters used at the beginning of a sentence or the first letter of proper nouns (names of people and places). The uppercase/capital letters in English are:ABCDEFGHIJKLMNOPQRSTUVWXYZUppercase letters are the opposite of the lowercase letters, which are:abcdefghijklmnopqrstuvwxyz
Change the name CALIFORNIA to names of other states by dropping some of the letters rearranging the remaining letters and then adding one new letter how many new names can you make?
Flordia Iowa Arizona
What are the country names with at least 5 letters?
Guatemala, Turkey, Germany, Panama, Czech Republic, Guatemala, Turkey, Germany, Panama, Czech Republic,
What are some of the names of the country starting with x?
No country begins with the letter X.
What are names that start with M and have 10 letters?
Marguerite is really one of the only common ten letter names starting with M.
What Italian cities have six letters in their names?
Examples of Italian cities that have six letters in their names include Milano, Napoli and Urbino.
Cars that start with letters of alphabet?
The names of cars start with letters of the alphabet. Some of the names are Acura, Chevrolet, Kia and Toyota.
Can you unscramble the letters celair?
The letters unscramble into two names and two words. Names: - Carlie - Claire Words: - Eclair - Lacier
What girl names are 6 letters long and start with s?
Girl names 6 letters long that begin with the letter S: Sandra Serena Shawna Silvia Sondra Sophia Stella Summer Sydney
Do names of plants and trees have to be capitalized?
not common names but botanical names definitely have a code to write the name of the genus with a capital letter and species with all small letters.
Why hurricane names start with a q or you?
hurricanes don't start with the letters "q" or "u" because there aren't many names that start those letters. "x", "z", and "y" are also letters that arent used for the first names of hurricanes
What are the next letter sequence jfmamjja?
sond (first letters of names of months in English
Why does the River Thames have a capital letter?
It's a name and names have initial capital letters.
How many names can you make using the letters of Halloween?
The letters can be used to spell the names Noel and Neal. They also spell Noah and Lee.
Do scientific names vary depending on the country you are working in?
No. Scientific names are scientific names no matter what country you are in. Common names, on the other hand, not only vary from country to country but can vary from region to region within the same country.
What names start with the letter in?
India is the name of a country. It begins with the letter in.
What is a 9 letter word for a vegetable?
Artichoke and asparagus are vegetable names that contain nine letters.
What is a good name for your tamagotchi?
Tamas for versions 4.5 and less can only hold maximum 5 character/letters. V5 can only have max. 5 characters/letters for a family name. Names that I like to use are pet names, human names, and some names like Tama. (My family name for V5 I used my first 2 letters of my name and my two sisters. Spelling Sikah. I thought it had 6 letters available so it cut off the last letter and I… Read More