0
why wont u answer correctly!?
What else can I help you with?
What body parts have 6 letters?
kidneyspleencheekspelvisfingermuscletonguenervesglands
What are some body parts with 6 letters in them?
spleen, kidney, artery, finger, radius, fibula, pelvis
How many letters are there in tennis?
6 letters 6 letters
What aer 6 body parts that have 3 letters each?
toe, eye, leg, arm, bum, and ear
What is flower that has 6 letters?
The dahlia has 6 letters.
What are the parts of alphabet?
The individual letters are the parts of the alphabet.
How many letters does Canada have?
6 letters You could always just count the letters that you typed.......
How do you find the number of combinations of 6 letters?
The number of combinations of 6 letters is 6! or 720.
How many letters are in the word office?
There are total of 6 letters in this word.
What is the answer to this number sequence 56565576?
first -- 5 letters second -- 6 letters third -- 5 letters fourth -- 6 letters fifth -- 5 letters sixth -- 5 letters seventh -- 7 letters eighth -- 6 letters So the nest number would be 5, because there are 5 letters in ninth.
How many ways can the letters of the word doodle be arranged?
36 different ways. Doodle has 6 letters all you do is multiply the numbers of letters by the number of letters (6 times 6). Also it depends on if you would like to use all 6 letters in the word or not.
Itv drama series 6 letters 9 letters 6 letters?
yes people like pie too.
