answersLogoWhite

0


Best Answer

'Flem' - from someone's throat that they spit out into the toilet and flush down which then enters the sewage system.

User Avatar

Wiki User

12y ago
This answer is:
User Avatar
More answers
User Avatar

AnswerBot

1mo ago

Some words that rhyme with "problem" and have to do with sewage are "globin" (a protein in sewage) and "bottom" (referring to the bottom of a sewage tank).

This answer is:
User Avatar

Add your answer:

Earn +20 pts
Q: What are words that rhyme with problem and have to do with sewage?
Write your answer...
Submit
Still have questions?
magnify glass
imp
Related questions

Does in rhyme with out?

No. The word "in" does not rhyme with out.Examples of words that rhyme with out:AboutBoutCloutDoubtFloutGoutGroutLoutPoutRoutShoutSnoutStoutToutTroutExamples of words that rhyme with in:BinDinFinGinHenMenSinTenTinWhenWenWinYenYinZen


How is sewage carried out of cities?

Sewage is carried out of city's with sewage pipes that leads to rivers, oceans and seas. The problem with that method, is sewage pollution, which could have malicious effects on the environment.


What words rhyme with gays?

Words that Rhyme with gays:baysblazebraiseclaysdaysdazeflaysglazegreysgrazehazejayslaysmazemaizeMaysneighsnayspaysphraseplayspraysraysslaysspaysspraysstaysstraystazetrayswaysWaze


How many words rhyme with yule?

30 words rhyme with yule.Some words that rhyme with yule:CoolCruelDroolDuelFerruleFeruleFoolFuelGhoulJewelMinisculeMinusculeMisruleMoleculeMuleOverrulePlayschoolPoolPuleRetoolRidiculeRuleSchoolSpoolStoolToolTulleUncoolVestibuleYou'll


What words rhyme with loop?

Words that rhyme with loop include:coopcroupdroophooppoopstoopsouptroop


Is sewage a problem in the maquarie river?

Yes! Der!


What is an external rhyme?

External rhyme is rhyme that happens on the "outside" of the poem. In other words, the words at the end of the lines rhyme.


Do star rhyming with sun?

No, star does not rhyme with sun.Some words that rhyme with star:afarajararebarcarcharfarjarmarparspartartsarSome words that rhyme with sun:bundonedunfungunhonnonenunonepunrunshunsonspunstuntonwon


Does eight rhyme with right?

No it doesn't.Some words that rhyme with right are:biteblightbrightbytecitefightflightfrightheightkiteknightlightmightmitenightplightquiteritesightsitesleightslightspitespritetighttritewhitewrightwriteSome words that rhyme with eight are:atebaitbatedatefategatehatelatematepateplateratesatetraitwaitweight


Does street rhyme with concrete?

Yes, street does rhyme with concrete. The only problem is that street is a one-syllable word, and to rhyme exactly with "concrete," the stress in "concrete" would need to be on the second syllable. So it's not an exact rhyme, but it's close.


What words rhyme with looks?

Words that rhyme with looks include:booksbrooksChinookscookscrookshooksnooks,rooksschnook


What is the term for when the middle of words rhyme?

The term for when the middle of words rhyme is called "internal rhyme." It occurs when words within the same line of poetry rhyme with each other.