'Flem' - from someone's throat that they spit out into the toilet and flush down which then enters the sewage system.
Some words that rhyme with "problem" and have to do with sewage are "globin" (a protein in sewage) and "bottom" (referring to the bottom of a sewage tank).
No. The word "in" does not rhyme with out.Examples of words that rhyme with out:AboutBoutCloutDoubtFloutGoutGroutLoutPoutRoutShoutSnoutStoutToutTroutExamples of words that rhyme with in:BinDinFinGinHenMenSinTenTinWhenWenWinYenYinZen
Sewage is carried out of city's with sewage pipes that leads to rivers, oceans and seas. The problem with that method, is sewage pollution, which could have malicious effects on the environment.
Words that Rhyme with gays:baysblazebraiseclaysdaysdazeflaysglazegreysgrazehazejayslaysmazemaizeMaysneighsnayspaysphraseplayspraysraysslaysspaysspraysstaysstraystazetrayswaysWaze
30 words rhyme with yule.Some words that rhyme with yule:CoolCruelDroolDuelFerruleFeruleFoolFuelGhoulJewelMinisculeMinusculeMisruleMoleculeMuleOverrulePlayschoolPoolPuleRetoolRidiculeRuleSchoolSpoolStoolToolTulleUncoolVestibuleYou'll
Words that rhyme with loop include:coopcroupdroophooppoopstoopsouptroop
Yes! Der!
External rhyme is rhyme that happens on the "outside" of the poem. In other words, the words at the end of the lines rhyme.
No, star does not rhyme with sun.Some words that rhyme with star:afarajararebarcarcharfarjarmarparspartartsarSome words that rhyme with sun:bundonedunfungunhonnonenunonepunrunshunsonspunstuntonwon
No it doesn't.Some words that rhyme with right are:biteblightbrightbytecitefightflightfrightheightkiteknightlightmightmitenightplightquiteritesightsitesleightslightspitespritetighttritewhitewrightwriteSome words that rhyme with eight are:atebaitbatedatefategatehatelatematepateplateratesatetraitwaitweight
Yes, street does rhyme with concrete. The only problem is that street is a one-syllable word, and to rhyme exactly with "concrete," the stress in "concrete" would need to be on the second syllable. So it's not an exact rhyme, but it's close.
Words that rhyme with looks include:booksbrooksChinookscookscrookshooksnooks,rooksschnook
The term for when the middle of words rhyme is called "internal rhyme." It occurs when words within the same line of poetry rhyme with each other.