answersLogoWhite

0

watched.

User Avatar

Wiki User

16y ago

What else can I help you with?

Related Questions

What 7 letter word has N as second letter and ends with letter D?

END


7 letter word starts with s ends with d?

seccond


What 7 letter word starts with a d and ends in an a?

dilemma, diploma


A 7 letter word that begins with d and ends with s?

details


A 7-letter word that begins with b and ends in d?

bastard, bustard, breaded, bearded, ..


What seven letter word starts with D and ends with T?

A seven letter word that starts with D and ends with T: decrypt


What is a seven letter word that ends in D?

discard


3 letter word that ends in d?

dad


Nine letter word that ends with a d?

unoccupied


7 letter word that stars with r and ends in d?

regluedredoundrichardrumagedroostedroustedraskindrenegedrubbledretiledredheadraveledredmondretiredrecrowdratwoodrelatedreblendreposedreoiledrumpledradferdrightedriveledremotedrosinedreinaldradioedrefloodrawheadradfordreswardresoledreestedrelaxedremisedredwardrepayedralliedrenamedroundedrecodedrefiredrebuildreveredrippledreavoidramheadrespondrebaledracemedreboundrebrandrebatedroadbedravagedrexfordrexferdrefacedrassledredfordrekeyedrumoredreifiedresumedreynoldrelinedremouldravinedriveredrepleadresawedresinedroachedrustledripenedribbandrepinedrewiredrosatedrefoundraggledresidedraddledretchedragweedrenewedrhizoidranchedrefriedrotuladrelivedrostandravenedripcordremovedrattledrelayedriffledrearmedrepliedrickardrissoidrecusedreratedrodwoodrunkledreveledresewedrankledreawardrebbredredriedriggaldreddledraymondreinoldruffordriocardroastedrennoldrenfredriobardrevokedraefordrefutedraywoodreheardramhoodremoridrevisedrefroidreaddedrepoundrecededraynoldruddledrabbledrebusedresizedredbirdreynardruddiedrivetedretypedruffledrowlandraifordrivaledrefixedrekneadreducedraimundrebraidrayfordretunedretreadrebreedreboardrezonedreguardredmundreactedraffledreyokedredodidroweledrecagedrefiledrumbledreahardrambledredatedrudyardresoundrevotedreyieldrewaxedrecitedresiledrefreidredaredrebukedrimlandrepavedretapedrewakedrimpledreputedreviledraymundrelacedrewoundrestiadreadiedreachedrichladrevivedroslandreferedremipedrollandrebakedroughedrelumedrheumedrenferdrotatedregaledrixfordrehonedrescuedrescindrehiredringoldreignedrastledroswaldraglandraynardrosebudrefinedredweedretimedriddledrumbaedranchodremixedrecanedrefugedreamendrazoredraylandredwoodrustredrefusedregrindresowedretriedridered


What is a 12 letter word that starts with L and ends with D?

Lighthearted is a 12 letter word. Lithographed is another 12 letter word that starts with L and ends with D.


Word that starts with the Letter D and ends with the letter n?

Domain is one of the words that starts with the letter D and ends with the letter N.