Palindrome.
There are several words that read the same forwards and backwards, and they are called palindromes. Some 5-letter palindromes are listed below.Common words:civickayaklevelmadamminimradarreferrotorsolosstatstenetUncommon words and proper nouns:Alulaanona (custard apple)Arara (a group or place name)deled (delete mark)Kazak (ethnic group)Siris (acronym)welew (to wither)Xanax (a drug trademark)
You need to roll the ball to hit the buttons in the same pattern that is on the doors. The pattern should be as follows: Left Right Right Left Left Left Right Right ... after you roll the ball and press the buttons in the correct order, the elevator doors will automatically open.
You have to cross the "fragile bridges" (cannot put all four parts of the block on them). There are 2 variations with the same number of moves. The 21 moves are: A) up right down left up right right right right right right up right down left up up right down left up U R D L U R6 U R D L U2 R D L U B) up left down right up up left down right up right right right right right right up right down left up U L D R U2 L D R U R6 U R D L U * note that the same 5 moves (URDLU) are used in both: once then twice in the first variation / once after ULDRU, then once more in the second variation.
Just play it the same, there are dance moves for the right and left hand.
away (can only be left or right) and b at the same time
No, 21 is not a palindrome. A palindrome is a number or word that remains the same when read in reverse order. In the case of 21, it is not the same number when read from right to left as it is when read from left to right.
Is a number that reads the same whether you read the digits from left to right or from right to left.
It is number whose digits read the same from left to right and from right to left. For example, 18645254681.
A palindrome is a number, or sequence of letters, that is read the same from left to right, as from right to left. For example, the word "noon" - if you read it backwards, you also get "noon".
The arrangement of characters from left to right in the string is the same as the arrangement of characters from right to left. e.g. MOM is a palindrome as it is same even if you read it from either left to right or right to left. while CAT is not a palindrome.
A palindrome is a word or phrase that can be read the same right to left or left to right. In this case, the answer would be "radar."
Yes, 'rotor' is a palindrome because it is spelled the same when read forwards or backwards (i.e., right to left or left to right)
81=18*4.5
A palindrome ("back-run" ) can be read left to right and right to left with the same meaning. For example Madam, I'm Adam.
No, because a palindrome is when a word is spelled exactly the same whether you read it left to right or right to left. The word 'tops' is not a palindrome because it is not spelled the same way if you read it from the last letter the first. An example of a palindrome is radar.
racecar, peepAnswer:Words which read the same in either direction are palindromes. There are also paindromic phrases like "Able was I ere I saw Elba" and "A Toyota. Race fast, safe car. A Toyota."
All three of these are palindromes. In other words, whether you read the letters from left to right or right to left, they say the same things.