answersLogoWhite

0

When did I'll Bet end?

User Avatar

Anonymous

∙ 11y ago
Updated: 8/21/2019

I'll Bet ended on 1965-09-24.

User Avatar

Wiki User

∙ 11y ago
Copy

What else can I help you with?

Related Questions

When did I Bet You Will end?

I Bet You Will ended on 2002-08-30.


When did I Bet You end?

I Bet You ended on 2008-07-10.


When did Ill Will Records end?

Ill Will Records ended in 2005.


Do guys admit when they like someone to a girl?

yes but im not a guy but ill bet they do


When did It's Your Bet end?

It's Your Bet ended in 1973-09.


When did BET Style end?

BET Style ended on 2006-07-06.


When did Best Bet end?

Best Bet ended on 2007-03-09.


When did You Bet Your Life end?

You Bet Your Life ended on 1960-06-10.


What is rear end casting number 3977323?

1974 c20 chevrolet rear axel. 4.56 gearing. 8 bolt wheel. {corporate 14} 8.5 gear. ill bet a pepsi on that one. thank you GW


Words that end in the letters ill?

billchilldilldrillfillfrillgillgrillhillinstillJillkillmillpillrefillshrillsillstillskillsillshillspillswilltwilltilltrillwilltilltrillthrillwill


Who wrote we're only going to die by your own arrogance originally?

ill bet anything it was Mark Twain


Did Kobe Bryant win a bet award?

Yes he ill win cuz Kobe is best player in world

Trending Questions
What are some important features to consider when choosing a biking water bottle? The Dallas Cowboys Cheerleader who played Stacy on the Love Boat Take my boyfriend please? Is the saturation of benzene the same to the other unsaturated hydro carbons? To be or not to be...is Hamlet considering suicide? What is the answer to this number sequence 0 12 72 240 600 1260 2352? Whats the name of the song where it says so you like my daughter do you now? Will citralpram anti depressant help for the symptoms of adhd? Is buju banton married? Which is the best Google Earth? When was Gregory Messina born? What do Nigerians People wear? When was navaratri festival days in 1983? What is the hinky pinky for a young mans honesty? What is the difference between article and schedule of constitution of India? How do you legally watch DVD on Wii? What website can you get anime figures at? The average income l in dollars of a lawyer with an age of x years is modeled with the following function I-425x245500x-650000? Where can one learn about option pricing? What makes the atmosphere unstable? What is 37cm in inches?

Resources

Leaderboard All Tags Unanswered

Top Categories

Algebra Chemistry Biology World History English Language Arts Psychology Computer Science Economics

Product

Community Guidelines Honor Code Flashcard Maker Study Guides Math Solver FAQ

Company

About Us Contact Us Terms of Service Privacy Policy Disclaimer Cookie Policy IP Issues
Answers Logo
Copyright ©2025 Answers.com. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.