answersLogoWhite

0

When did I'll Bet end?

User Avatar

Anonymous

∙ 11y ago
Updated: 8/21/2019

I'll Bet ended on 1965-09-24.

User Avatar

Wiki User

∙ 11y ago
Copy

What else can I help you with?

Related Questions

When did I Bet You Will end?

I Bet You Will ended on 2002-08-30.


When did I Bet You end?

I Bet You ended on 2008-07-10.


When did Ill Will Records end?

Ill Will Records ended in 2005.


Do guys admit when they like someone to a girl?

yes but im not a guy but ill bet they do


When did It's Your Bet end?

It's Your Bet ended in 1973-09.


When did BET Style end?

BET Style ended on 2006-07-06.


When did Best Bet end?

Best Bet ended on 2007-03-09.


When did You Bet Your Life end?

You Bet Your Life ended on 1960-06-10.


What is rear end casting number 3977323?

1974 c20 chevrolet rear axel. 4.56 gearing. 8 bolt wheel. {corporate 14} 8.5 gear. ill bet a pepsi on that one. thank you GW


Words that end in the letters ill?

billchilldilldrillfillfrillgillgrillhillinstillJillkillmillpillrefillshrillsillstillskillsillshillspillswilltwilltilltrillwilltilltrillthrillwill


Who wrote we're only going to die by your own arrogance originally?

ill bet anything it was Mark Twain


Did Kobe Bryant win a bet award?

Yes he ill win cuz Kobe is best player in world

Trending Questions
Which is correct you are welcome to stay or you are welcomed to stay? Where does the walk of fame start and end? What rhymes with threats? How old is her sister roslyn Jordan? What vaccines are required for international travelers? What are the 8 kinds of spech? What happened toGreek democratic practices when Philip ii of Macedonia conquered Greece? Where did the word can come from? Blue top tube is drawn for? Why did my sequence disappear in Adobe Premiere? Can Lexapro withdrawal cause hives or rashes? Where can someone find a list of restaurants and bars in Toronto? Say 'Happy Holidays' in German? Does a 95 Ford Thunder Bird have an airbag? Is Nigeria near the coast? Is Reba MacEntire a lesbian? What does mittel mean in English? What was vivienne westwood influenced by? Is it safe to take iron supplements with calcium, or should they be taken separately to avoid any potential interactions? Something you wear beginning with c?

Resources

Leaderboard All Tags Unanswered

Top Categories

Algebra Chemistry Biology World History English Language Arts Psychology Computer Science Economics

Product

Community Guidelines Honor Code Flashcard Maker Study Guides Math Solver FAQ

Company

About Us Contact Us Terms of Service Privacy Policy Disclaimer Cookie Policy IP Issues
Answers Logo
Copyright ©2025 Answers.com. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.