Tags Human Anatomy and Physiology

Animals & Plants Arts & Entertainment Auto Beauty & Health Books and Literature Business Electronics Engineering & Technology Food & Drink History Hobbies Jobs & Education Law & Government Math People & Society Science Social Studies Sports Travel & Places

0

Subjects>Science>Biology

Which body parts have 5 letters?

Updated: 8/11/2023

Wiki User

∙ 15y ago

Best Answer

· ankle

· aorta

· beard

· belly

· blood

· bones

· brain

· cells

· cheek

· chest

· colon

· femur

· fovea

· groin

· hands

· heart

· knees

· limbs

· liver

· lungs

· mouth

· molar

· nails

· navel

· nerve

· organ

· ovary

· penis

· pupil

· scalp

· sinus

· skull

· spine

· teeth

· thigh

· tibia

· tooth

· torso

· veins

· vulva

· waist

· wrist

palms

heels

bones

elbow

gland

thumb

Wiki User

∙ 11y ago

This answer is:

More answers

Wiki User

∙ 10y ago

· arm

· hip

· leg

· rib

· toe

This answer is:

Wiki User

∙ 14y ago

Take your pick:

arm ear
eye
gum
hip
jaw
leg
lip
rib
toe

This answer is:

Wiki User

∙ 13y ago

Eye, Ear, Lip, Gum, and Jaw

This answer is:

Wiki User

∙ 15y ago

Mouth... LOL!

This answer is:

Greysen Luongo ∙

Lvl 2

∙ 11mo ago

brain

This answer is:

Add your answer:

Earn +20 pts

Q: Which body parts have 5 letters?

Write your answer...

Submit

Still have questions?

imp

Continue Learning about Biology

How many human body parts are spelled with three letters only?

ear leg eye arm <LI>lip</LI> <LI>toe</LI> <LI>hip</LI> <LI>toe</LI> <LI>fat</LI> <LI>gum </LI>

How many moving parts doe the human body have?

172

What are all the human body parts that have nine letters?

eye, ear, lip, gum, jaw, arm, rib, hip, leg, and toe

11 parts of the body with 3 letters?

toe, eye, arm leg, jaw, lip, hip, ear, rib, gum, lid

What is group of trees called with 5 letters?

a small group (5 letters)

Related questions

The 5 lower parts of your body that has 3 letters?

I think the answer is leg, toe, hip, rib, and gut.

What body parts have 9 letters?

what skeletal as 9 letters

What body parts have 6 letters?

kidneyspleencheekspelvisfingermuscletonguenervesglands

Which arm parts have 5 letters?

Elbow?

Give the four parts of letters?

parts of a letter: * heading * greeting * body * closing

What are human body parts beginning with the letters you?

Ulna, uterus

Which body parts have five letters in them and begin with e?

elbow

What are some body parts that begin with the letters CL?

clavicle

What are some body parts that are 3 letters long?

armeareyelegliptoe

Unscramble these letters XRTAHO to name parts of the body starting with the letter t?

The letters spell the word thorax. It is a body part.

10 body parts that has thrre letters in it?

Eye, toe, jaw, hip, arm and rib are body parts. Additional body parts include ear, leg, gum and lip.

Body parts with only 4 letters?

Anus, iris, feet, gums and calf are body parts. Additional body parts include nail, neck, face, nose, foot, cell and chin.

Trending Questions

Why is the anterior talofibular ligament the most commonly injured ligament in the ankle? Why is it that in some families all the siblings are the same sex? Describe the cyclic nature of the reactions in the Krebs cycle? Is Edwards syndrome autosomal or sex-linked? Parents can pass on chromosomes to their children that are different than their own when the new gene combinations are created by? Butterfly a symbol for new beginnings? In humans blood type inheritance is an example of what? What contains chlorophyll site of photosynthesis? What does a b2 blood test mean? What is the main way individual's leave a population? What are the scenarios of passing turner syndrome? What is the fasciculi that surrounds connective tissue called? What is the phenotype of a heterozygous individual what is the genotype of a heterozygous individual? What are some products made by a deciduous trees? What are the four essential functions of epithelial tissue? Is it normal not to get butterflies when i see my boyfriend? How does boiling an enzyme effects its activity? What are The three types of homologies are? Why are sprains and cartilage injuries a particular problem? What are the four types of vertebrate tissues and their function?

Still have questions?

imp

Previously Viewed

Which body parts have 5 letters?

Resources

Top Categories

Product

Company

Copyright ©2024 Infospace Holdings LLC, A System1 Company. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.