0
The alternative to concrete nouns is abstract nouns.
Examples of abstract nouns are: ability, beauty, curiosity, drama, ego, fun, government, hope, idea, joy, knowledge, lesson, memory, need, opinion, question, romance, sorrow, trouble, urge, valor, wisdom, year, zeal.
Examples of concrete nouns are: acorn, baby, chair, diamond, egg, fudge, grass, house, ice, juice, kangaroo, lamp, mountain, nickel, oxygen, person, quilt, rust, star, turtle, umbrella, violet, wind, yeast, zebra.
What else can I help you with?
What are some non examples coefficient?
Green, the sun, a motor car, heat are all non examples!
What are some examples of non integer rational number?
Some examples are 1/3, -4/7, 5 3/4, -6.37
What are examples of non-count?
The term non count is in reference to items are nouns that we cannot count. It is things that cannot be plural. Some examples are, luck, hate, laughter, beauty and patience.
Is rust a count noun or a non-count noun?
The noun rust is a non-count noun. Units of rust are worded as 'spots of rust' or 'patches of rust'
Can you give 50 examples of non- count nouns?
Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance
What are collective and non countable nouns?
A collective noun is a word used to group people or things in a descriptive way. Some examples (in bold) are:a staff of employeesa flock of pigeonsa bouquet of flowersa bank of elevatorsA non-count noun is a noun for something that can't be counted, words for substances or aggregates of something. Some examples are:aluminummilkeducationnewsUnits of an uncountable noun uses a partitive noun (also called a noun counter) to define number or quantity. Some examples (in bold) are:a set of luggagea piece of advicea cup of floura yard of concrete
Which noun is paneer?
A paneer is a soft, non-matured Indian cheese.
Concrete is an example of what?
Concrete is a noun category for something physical; a concrete noun.The noun concrete is a material noun, a noun for something used to make other things.The noun concrete is a non-count (mass) noun for a substance; the plural form is used only for types of concrete.The noun concrete is a common noun, a word for any concrete.Concrete is a compound, a mixture of water, cement, and aggregate; a building material used for its strength and endurance.
What type of noun is door?
Door to success is an abstract noun. It depends
What are some non examples of media?
some examples of non print media are ...
What are non-examples of crystal?
Crumbled glass from a car windshield. Concrete aggregate. These are not crystals.
What is the noun of non silicate?
The noun non silicate (or non-silicate) is a common, concrete noun; a word for a type of mineral; a word for a thing. The noun non silicate is an uncountable (mass) noun as a word for a substance. The plural form non-silicates is reserved for 'types of' or 'kinds of'.
What are some non examples of omnivores?
What are non examples of omnivores
What are some examples of non tax revenues?
what are some examples of non-tax revenue
What kind of noun is cat?
The word "cat" is a common noun, specifically a concrete, countable noun. Common nouns refer to general, non-specific entities, while concrete nouns represent tangible objects. Countable nouns can be quantified and have both singular and plural forms.
What are some non-examples of protein?
Water, vitamins, and minerals are some examples of non-proteins.
Is wood a concrete noun or abstract noun?
The noun 'fish' is a concretenoun, a word for a creature that lives in water; a word for a physical thing.
