0
What else can I help you with?
Related Questions
Three letter word for accomplished starting with t?
A three-letter word for accomplished is usually "did." Perhaps the "t" is incorrect.
Is s before t in the afebet?
Yes, in the English alphabet, the letter "s" comes before the letter "t." The order of the alphabet places "s" as the 19th letter and "t" as the 20th letter.
What word contains the letter t three times?
The word "tattletale" contains the letter T three times.
What is the T for?
its the letter before "shirt"
What is the t?
its the letter before "shirt"
What is a three letter palindrome for the evening or day before?
Eve is a three letter palindrome for the evening or day before.
What is a three letter word with t at the end?
Cat
What three letter words end with t?
notbatartrathitsitlitkitbitnitwitzitpitfitgittitfatsatcathatmatpatsattatvatwetyetvetbetgetjetletmetpetsetbotcotdotgothotjotlotpotrottotbutcutguthutjutnutputrut
What is a three-letter word with t in the middle?
it is ATE,
What is a three letter word for fractional endings with first letter as 'T'?
THS
Three letter word beginning with T without repeating any letter?
tea??
A three letter word for bird that starts with t?
tit
Trending Questions
What is girl fellow fellow mean brain teaser?
What is the material used to make adult toys?
What is the next color in this sequence Yellow Blue Red Purple Orange?
What is the last word of keesh?
More ending in y that sound like sky?
What is considered the best cribbage hand?
What type of paper fold effects how far the paper airplane goes?
What is an Occupation that starts with the letter b?
What is another word for money paid for a journey?
What five letter word sounds the same when 3 letters the first middle and last letter are taken away?
What are Kapampangan words?
What is a special role an organism plays in an environment?
What rhymes with chemo?
Atomic number 47 used to make photographic film?
What are some nouns that begin with the letter W?
What are some subcategories of Arts and Entertainment?
What is a thirteen letter word for the french and Indian revolution?
How do you open a mini book puzzle box?
What does a heart sound like in words?
What is a knock in gin rummy and how does it affect the outcome of the game?
Copyright ©2025 Infospace Holdings LLC, A System1 Company. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.