0
The word stars is a count noun, the plural form for the singular star.
A count noun is a word that has both a singular and a plural form.
Wiki User
∙ 11y ago
Add your answer:
Earn +20 pts
What do high mass stars and low mass stars have in common?
They produce light.
What nouns describe stars?
Nouns do NOT describe stars. The word 'star' is a noun in its own right. It is adjectives that describe stars. Adjectives are 'starry' (rather infantile) , and 'stellar'. e.g. The starry night sky . or , The stellar night sky.
Is the sun a low mass or high mass star?
There are more low mass stars. this is for two reasons:- # the star forming process generates more low mass stars # High mass stars burn out very quickly and explode as supernovas and thus over time there are less and less of them.
What is made when stars die?
There are three types of stellar remnants. Low to medium mass stars will become white dwarfs. High mass stars will become neutron stars. Very high mass stars will become black holes.
What are both high mass and low mass adult stars classified as?
Main Sequence Stars
Give example of mass noun lists?
Water, rice, sugar, milk, sand, flour, oil, furniture, luggage, clothing.
How can you identify a bottle of perfume. is it count nouns or mass nouns?
1. you will identify if is it mass nouns or count nouns by this way: count nouns:nouns that you can count......you will identify that if you can count that thing or noun ex: 5 containers mass nouns:nouns that can not be counted......you will identify it if you can not count that noun like liquids ex: leaves on a tree clouds in the sky
Is plant a mass or count nouns?
Plant is a count noun because you can count plants such as two geraniums or ten trees. Their beauty or their strength are mass nouns.
Is seas a count noun?
No,It is a Mass Noun. Mass nouns are nouns the can't be counted.Examples:water bloodsand grass
What are 5 mass examples nouns?
Mass (uncountable) nouns are words for things that you cannot count, such as substances or concepts.Some examples are:teanewsaluminumelectricityinformation
What is the name of a word that has no plural form?
Nouns that have no plural form are called mass nouns, uncountable nouns, or non-count nouns.
Can you give 50 examples of non- count nouns?
Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance
Are papers mass nouns or count nouns?
The noun 'papers' is a countnoun, the plural form of the singular noun 'paper'.
What are the 3 categories of nouns?
The three main categories of nouns are:common or propersingular or pluralabstract or concreteSome other categories of nouns are:count or non-count (mass nouns)possessivecollectivecompoundgerundsmaterialattributive
Box of chocolate mass or count noun?
A box of chocolate is a count nouns, for example, one box or two boxes of chocolate.
Can you give me five examples of a mass?
Mass (uncountable) nouns are words for things that you cannot count, such as substances or concepts.Some examples are:sugarfurniturealuminuminformationknowledge
What are the 7 kinds of nouns?
The kinds of nouns are:singular and plural nounscommon and proper nounsabstract and concrete nounspossessive nounscollective nounscompound nounscount and non-count (mass) nounsgerunds (verbal nouns)material nouns
