The word stars is a count noun, the plural form for the singular star.
A count noun is a word that has both a singular and a plural form.
They produce light.
Nouns do NOT describe stars. The word 'star' is a noun in its own right. It is adjectives that describe stars. Adjectives are 'starry' (rather infantile) , and 'stellar'. e.g. The starry night sky . or , The stellar night sky.
There are more low mass stars. this is for two reasons:- # the star forming process generates more low mass stars # High mass stars burn out very quickly and explode as supernovas and thus over time there are less and less of them.
There are three types of stellar remnants. Low to medium mass stars will become white dwarfs. High mass stars will become neutron stars. Very high mass stars will become black holes.
Main Sequence Stars
Water, rice, sugar, milk, sand, flour, oil, furniture, luggage, clothing.
1. you will identify if is it mass nouns or count nouns by this way: count nouns:nouns that you can count......you will identify that if you can count that thing or noun ex: 5 containers mass nouns:nouns that can not be counted......you will identify it if you can not count that noun like liquids ex: leaves on a tree clouds in the sky
Plant is a count noun because you can count plants such as two geraniums or ten trees. Their beauty or their strength are mass nouns.
No,It is a Mass Noun. Mass nouns are nouns the can't be counted.Examples:water bloodsand grass
Mass (uncountable) nouns are words for things that you cannot count, such as substances or concepts.Some examples are:teanewsaluminumelectricityinformation
Nouns that have no plural form are called mass nouns, uncountable nouns, or non-count nouns.
Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance
The noun 'papers' is a countnoun, the plural form of the singular noun 'paper'.
The three main categories of nouns are:common or propersingular or pluralabstract or concreteSome other categories of nouns are:count or non-count (mass nouns)possessivecollectivecompoundgerundsmaterialattributive
A box of chocolate is a count nouns, for example, one box or two boxes of chocolate.
Mass (uncountable) nouns are words for things that you cannot count, such as substances or concepts.Some examples are:sugarfurniturealuminuminformationknowledge
The kinds of nouns are:singular and plural nounscommon and proper nounsabstract and concrete nounspossessive nounscollective nounscompound nounscount and non-count (mass) nounsgerunds (verbal nouns)material nouns