eadish, eagers, eagles, eaglet, earcap, earful, earing, earlap, earlet, earned, earner, earths, earthy, earwax, earwig, easels, easers, easier, easies, easily, easing, easter, eatage, eaters, eatery, eating, ebbing, ebcdic, eburin, ecarte, ecbole, echini, echoed, echoer, echoes, echoey, echoic, echoon, eclair, eclats, eclegm, ecoles, ecoute, ectopy, ectype, ecurie, eczema, eddaic, eddied, eddies, eddish, eddoes, edemas, edenic, edgers, edgier, edgily, edging, edible, edicts, edison, edited, editor, educed, educes, educts, edward, eelier, eelpot, eerier, eerily, efface, effect, effete, effigy, efflux, efform, effort, effray, effume, effund, effuse, efreet, egence, egesta, eggcup, eggers, eggery, egghot, egging, eggler, eggnog, egises, egling, egoism, egoist, egoity, egress, egrets, egriot, ehlite, eiders, eidola, eiffel, eighth, eights, eighty, eiking, either, ejecta, ejects, ekabor, elaeis, elaine, elance, elands, elanet, elapse, elated, elater, elates, elbows, elcaja, eldern, elders, eldest, elding, elects, elegit, elemin, elench, elenge, eleven, elevon, elfins, elfish, elfkin, elicit, elided, elides, elijah, elison, elisor, elites, elixir, elknut, elleck, elmier, elohim, eloign, eloped, eloper, elopes, elrich, eluded, eluder, eludes, elvers, elvish, elwand, elysia, elytra, embace, embale, emball, embalm, embank, embark, embars, embase, embays, embeam, embeds, embers, emblem, embody, emboil, emboli, emboly, emboss, embowl, embows, embrew, embrue, embryo, embulk, embush, embusy, emceed, emcees, emeers, emends, emerge, emeril, emesis, emetic, emeute, emigre, emmets, emmies, emmove, emodin, emoted, emoter, emotes, empair, empale, empark, empasm, empawn, empery, empire, employ, emptor, empugn, empuse, emrods, emulge, emydea, enable, enacts, enamel, enamor, enarch, enates, enatic, enbibe, encage, encamp, encase, encash, encave, encina, encode, encore, encowl, encyst, endark, endear, enders, endict, ending, endite, endive, endome, endoss, endows, endrin, endued, endues, endure, enduro, endyma, enemas, energy, enerve, enface, enfant, enfect, enfire, enfold, enform, enfree, engage, engaol, engild, engine, engird, engirt, englue, englut, engore, engram, engulf, enhalo, enhort, enigma, enjall, enjoin, enjoys, enlace, enlard, enlimn, enlink, enlist, enlive, enlock, enlute, enmesh, enmist, enmity, enmove, enmure, ennead, ennuis, ennuye, enodal, enoint, enopla, enough, enrace, enrage, enrank, enrapt, enrich, enring, enrive, enrobe, enroll, enrols, enroot, ensafe, ensate, enseal, enseam, ensear, enseel, ensign, ensile, ensoul, ensued, ensues, ensure, entail, entame, entend, enters, entice, entire, entity, entoil, entomb, entrap, entree, entune, envied, envier, envies, envois, envoys, enwall, enwind, enwomb, enwrap, enzyme, eocene, eolian, eolith, eonian, eozoic, eozoon, eparch, epaule, epeira, ephori, ephors, ephyra, epical, epigee, epigon, epilog, epizoa, epocha, epochs, epodic, eponym, epopee, epulis, equals, equant, equate, equery, equine, equips, equity, erased, eraser, erases, erbium, erebus, erects, erenow, ergots, eriach, ericas, eringo, erinys, ermine, ernest, eroded, erodes, eroses, erotic, errand, errant, errata, erring, errors, ersatz, erucae, erucic, eructs, erupts, eryngo, escape, escarp, escars, eschar, eschew, escort, escout, escrod, escrol, escrow, escudo, eskimo, esloin, esnecy, esodic, esopic, espace, espial, espied, espier, espies, esprit, essays, essene, essoin, estate, esteem, esters, esther, estops, estray, estrin, estrum, estrus, estufa, esture, etched, etcher, etches, eterne, ethane, ethene, ethers, ethics, ethide, ethine, ethiop, ethnic, ethule, ethyls, etnean, etoile, etudes, etymic, etymon, euchre, Euclid, eugene, eugeny, eulogy, eunomy, eunuch, eureka, Europe, eutaxy, evaded, evader, evades, evanid, evened, evener, evenly, events, everse, everts, evicts, eviler, evilly, evince, evoked, evoker, evokes, evolve, evomit, evzone, exacta, exacts, exaled, exalts, examen, exarch, excamb, excave, exceed, excels, except, excern, excerp, excess, excide, excise, excite, excoct, excuse, excuss, exedra, exempt, exequy, exerts, exeunt, exhale, exhort, exhume, exiled, exiles, exilic, exists, exited, exmoor, exodic, exodus, exogen, exolve, exotic, expand, expect, expede, expels, expend, expert, expire, expiry, explat, expone, export, expose, expugn, exsect, exsert, extacy, extant, extasy, extend, extent, extern, extill, extine, extirp, extoll, extols, extort, extras, exuded, exudes, exults, exurbs, exuvia, eyalet, eyebar, eyecup, eyeful, eyeing, eyelet, eyelid, eyghen, eyliad, eyries, eysell,
sablesaltysandysaladsharesharpshanksharkskimpskillskirtslimesliceslideslopescuffscorescarfscramsmallsmilesmokespadespanksparkspeckspendspellsinceswordsheetsheersheepsceneshearsheikshakeshellshallskunkstinkstankstunkstartstampshameshiftshineswarmstormstoopstoolstovestonestolesweetsweatswearswornstumpstungstuckstackstickstockstripsteamstealsteelswingstingsnakesnackswingsmartstrumstorestorksmock
· pathetic · petty · pitiful · plump
obnoxious obese overconfident That's all i can think of for now:P
Belligerent, boastful, boring and bossy are negative words. Bad, bratty and bully are negative words.
There are no such words.
To have a reasonable list, you should specify a starting letter. However, there is a website that provides enormous lists like this. See the related link below.
Yes.
Kick
Six letter words starting with N:naggednailednapkinnationnaturenectarnearlyneaterneatlyneededneedleneckednegatenervesnestednestleneuternibblenicelynickelniecesnightsnimbleninetynogginnipplenobodynoodlenormalnoticenotionnovelsnovicenozzlenudgednuggetnursesnumbernurishnuzzlenylons
Moods that start with the letter L:loathinglonelinesslovelust
Some 7 letter S words are:salvagesauntersausagesandingscatterscamperscratchscuffleseasicksectionselfishsendingserioussessionshapelyshiftedsharpenshattershackleshakingsharingshimmershowingshuttershovelsshortlyshowersshuttlesickbedsizzledskilledskatingslammerslimmersmudgedsnaggedsnarledsnowmansnowingsnorkelsolvingsoldierspatterspecialspoiledsputterstaffedstaggerstalkerstarvedstammerstapledstationstartlestiffenstoragestressedstretchstingerstringystrikesstumblestutterstylishsubjectsublimesuctionsugaredsummarysupportsupposeswaggersweatersweeperswelterswingerswimmersyringe
Some four letter words that start with U are:uglyulnaundountouponureaurgeused