answersLogoWhite

0

This is a weird question -- almost anything could be a NON example. So ... dignity is a non-example.

User Avatar

Ambrose Krajcik

Lvl 13
3y ago

What else can I help you with?

Related Questions

What are some non examples of volume?

Time, temperature, and weight are examples of non-examples of volume. Time is a measure of duration, temperature is a measure of heat, and weight is a measure of mass.


What are some non examples of mass wasting?

Glacial erosion, volcanic eruptions, and earthquake-induced landslides are some non-examples of mass wasting. These processes do not involve the downslope movement of material under the influence of gravity, which is a defining characteristic of mass wasting.


Can you give 50 examples of non- count nouns?

Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance


What are some non examples of media?

some examples of non print media are ...


What are some non examples of omnivores?

What are non examples of omnivores


What is a Non examples of mass?

atomic number atomic weight


What are some examples of non tax revenues?

what are some examples of non-tax revenue


What are some of examples of non-matter?

Matter is real and has physical mass.5 examples of matter could include:- lead, air, water, timber, books.5 examples of non-matter would include :- speech, light, vacuum, logic, faith.


What are some non-examples of protein?

Water, vitamins, and minerals are some examples of non-proteins.


What are non-examples of glucose?

Some Non Examples Of Glucose Is Hoodies,Hair,ClothesEtc..


what is the non examples of mass?

how fast something goes like the speed of a car


What are some non examples of landforms?

non examples are anything made by a human on land that is not natural