answersLogoWhite

0

This is a weird question -- almost anything could be a NON example. So ... dignity is a non-example.

User Avatar

Wiki User

9y ago

What else can I help you with?

Related Questions

What are some examples of mass wasting?

This is a weird question -- almost anything could be a NON example. So ... dignity is a non-example.


What is a non example of mass wasting?

The movement of water in a river is a non-example of mass wasting. Mass wasting involves the downslope movement of rock and soil due to gravity, while the movement of water in a river is governed by the flow of the water itself.


What are some non examples of of mass?

This is a weird question -- almost anything could be a NON example. So ... dignity is a non-example.


What are some non examples of volume?

Time, temperature, and weight are examples of non-examples of volume. Time is a measure of duration, temperature is a measure of heat, and weight is a measure of mass.


Can you give 50 examples of non- count nouns?

Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance


What are some non examples of media?

some examples of non print media are ...


What are some non examples of omnivores?

What are non examples of omnivores


What is a Non examples of mass?

atomic number atomic weight


What are some examples of non tax revenues?

what are some examples of non-tax revenue


What are non constructive forces?

Non-constructive forces, also known as destructive forces, are those that wear down or destroy existing landforms. Examples include weathering, erosion, and mass wasting. These forces play a role in shaping the Earth's surface over time.


What are some non-examples of protein?

Water, vitamins, and minerals are some examples of non-proteins.


What are some of examples of non-matter?

Matter is real and has physical mass.5 examples of matter could include:- lead, air, water, timber, books.5 examples of non-matter would include :- speech, light, vacuum, logic, faith.