answersLogoWhite

0

This is a weird question -- almost anything could be a NON example. So ... dignity is a non-example.

User Avatar

Wiki User

9y ago

What else can I help you with?

Related Questions

What are some examples of mass wasting?

This is a weird question -- almost anything could be a NON example. So ... dignity is a non-example.


What is a non example of mass wasting?

The movement of water in a river is a non-example of mass wasting. Mass wasting involves the downslope movement of rock and soil due to gravity, while the movement of water in a river is governed by the flow of the water itself.


What are some non examples of of mass?

This is a weird question -- almost anything could be a NON example. So ... dignity is a non-example.


What are some non examples of volume?

Time, temperature, and weight are examples of non-examples of volume. Time is a measure of duration, temperature is a measure of heat, and weight is a measure of mass.


Can you give 50 examples of non- count nouns?

Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance


What are some non examples of media?

some examples of non print media are ...


What are non constructive forces?

Non-constructive forces, also known as destructive forces, are those that wear down or destroy existing landforms. Examples include weathering, erosion, and mass wasting. These forces play a role in shaping the Earth's surface over time.


What are some non examples of omnivores?

What are non examples of omnivores


What is a Non examples of mass?

atomic number atomic weight


What are some examples of non tax revenues?

what are some examples of non-tax revenue


What are some of examples of non-matter?

Matter is real and has physical mass.5 examples of matter could include:- lead, air, water, timber, books.5 examples of non-matter would include :- speech, light, vacuum, logic, faith.


What are some non-examples of protein?

Water, vitamins, and minerals are some examples of non-proteins.