answersLogoWhite

0

Nutrition guidelines

*Food exchange list

*Dietary standard & Nutrient Density

*Nutrition Facts

*Food composition table

User Avatar

Wiki User

13y ago

What else can I help you with?

Related Questions

What are the Basic tools in nutrition?

THE basic tools in study of nutrition are: *Nutrition guidelines *Food exchange list *Dietary standard & Nutrient Density *Nutrition Facts *Food composition table


Basic tools in nutrition?

The basic tools in nutrition mainly revolve around diet and exercises. These will define the components of your diet and the relevant exercises that will keep you healthy and fit.


In nutrition tool what are the advantages and disadvantages of food group?

what are the disadvantages and advantages tools in nutrition? what are the disadvantages and advantages tools in nutrition?


5 basic building blocks of nutrition?

five basic building blocks of nutrition


What are some of the geographer basic tools?

what are some of the geographers basic tools


What are two basic types of nutrition?

There are primary forms of nutrients, macronutrients and micronutrients. The three main classes of macronutrients encompass carbohydrate, protein, and fat. The forms of micronutrients are vitamins and minerals, and those are greater molecules that cells need to make power.


What effect does basic nutrition have on your fitness?

nutrtition helps lol


What is a reliable nutrition database?

http://www.nutritionco.com/ is a reliable nutrition database. It gives you basic guidelines for nutrition, and it also gives you ways to apply them to your everyday life, and to make informed nutrition decisions.


One of the basic tools available to control simple learning is?

Support is one of the basic tools available to control simple learning.


Is phagocytosis autotrophic nutrition or heterotrophic nutrition?

heterotrophic in very basic, general terms: it "engulfs" it's prey. (like an amoeba!)


What is optical tools?

Um glasses the most basic of optical tools!


What are the three basic elements of good nutrition?

The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater