0
What else can I help you with?
Can a single medium function for both differentiation and selectivity?
yes...by removing certain growth factors such as amino acid,vitamins etc which would inhibit the growth of a desired organism
What nutrient needed for the growth and repair of cells is?
Protein is the nutrient needed for growth and repair of cells. Protein provides the building blocks (amino acids) necessary for cellular function, growth, and tissue repair. Including sources of protein in your diet such as meat, fish, dairy, legumes, and nuts can help support cell growth and repair.
What is the function of each ingredient of nutrient agar?
Agar: Acts as a solidifying agent to provide a solid surface for bacterial growth. Beef extract: Provides amino acids, vitamins, and minerals as nutrients for bacterial growth. Peptone: Another source of amino acids and peptides for bacterial metabolism. Sodium chloride: Provides essential ions for bacterial cell function and maintaining osmotic balance.
What are the amino acids in leaves?
The most common amino acids found in leaves are alanine, serine, glutamate, glutamine, and aspartate. These amino acids play important roles in plant metabolism, growth, and response to environmental stress.
What are two function groups of amino acids?
The functional groups of an amino acid are the amino group (-NH2) and the carboxyl group (-COOH).
What is the amino acid structure of tubulin?
That'll vary depending on which tubulin protein you look at, as there are different types, and variation between species as well. If you don't know which one to look for, take a bovine (cow) or porcine (pig) alpha/beta tubulin. For the most complete set of data on its structure, find a pdb file (search Google for "pdb" and use the search functions of one of those websites to find tubulin). For less detailed structure, you can find its "FASTA" sequence. RCSB (find it on Google) will allow you to download the pdb file and the FASTA sequence for any known protein. You can also find the original paper that described the amino acid sequence - just search Google. If you don't find it on Google, chances are you'll have to pay for it! If you really don't mind which tubulin you get the structure of, use this one to save some time. It is the bovine (cow/cattle) alpha and beta tubulin monomers. The structure was derived as a dimer, so there are two sequences here. The first one is the beta chain, the second one is the alpha chain. >1JFF:B|PDBID|CHAIN|SEQUENCE MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSY HGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTM DSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTE GAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTG SGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEP YNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTP TYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNM VPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE QMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMS ATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGE GMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEF EEEGEEDEA >1JFF:A|PDBID|CHAIN|SEQUENCE MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPT VIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIG KEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGF TSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNS ILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTN LNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRG HFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMV KCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTI QFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCML SNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME EGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY
What is the role of the most abundant amino acid in the body in maintaining overall health and function?
The most abundant amino acid in the body, glutamine, plays a crucial role in maintaining overall health and function by supporting immune function, promoting muscle growth and repair, and aiding in digestive health.
Can a single medium function for both differentiation and selectivity?
yes...by removing certain growth factors such as amino acid,vitamins etc which would inhibit the growth of a desired organism
Amino acid function?
Amino acids are basically known as the building blocks of protein. The function of an amino acid is primarily to build proteins.
What nutrient are essential for body growth or repair?
Proteins. And proteins require different vitamins, enzymes, minerals and amino acids to function properly.
Nutrient that is essential for body growth and repair?
Proteins. And proteins require different vitamins, enzymes, minerals and amino acids to function properly.
What nutrient needed for the growth and repair of cells is?
Protein is the nutrient needed for growth and repair of cells. Protein provides the building blocks (amino acids) necessary for cellular function, growth, and tissue repair. Including sources of protein in your diet such as meat, fish, dairy, legumes, and nuts can help support cell growth and repair.
What is the function of each ingredient of nutrient agar?
Agar: Acts as a solidifying agent to provide a solid surface for bacterial growth. Beef extract: Provides amino acids, vitamins, and minerals as nutrients for bacterial growth. Peptone: Another source of amino acids and peptides for bacterial metabolism. Sodium chloride: Provides essential ions for bacterial cell function and maintaining osmotic balance.
Is amino acid good for you and why?
Yes, amino acids are good for you because they are the building blocks of proteins, which are essential for various bodily functions such as muscle growth, repair, and overall health. Amino acids also play a role in supporting the immune system, hormone production, and neurotransmitter function.
What is the function of insulin?
The major function of insulin is to maintain appropriate blood glucose levels. It basically controls the transport of glucose to the cells in your body. It also stimulates growth and increases amino acid transport into cells.
What are the amino acids in leaves?
The most common amino acids found in leaves are alanine, serine, glutamate, glutamine, and aspartate. These amino acids play important roles in plant metabolism, growth, and response to environmental stress.
The function of most proteins depends primarily on the?
The function of most proteins depends primarily on their structure, which is determined by their amino acid sequence. The unique sequence of amino acids in a protein dictates its shape and function, allowing it to carry out specific biochemical tasks in the body.
