0
That'll vary depending on which tubulin protein you look at, as there are different types, and variation between species as well.
If you don't know which one to look for, take a bovine (cow) or porcine (pig) alpha/beta tubulin.
For the most complete set of data on its structure, find a pdb file (search Google for "pdb" and use the search functions of one of those websites to find tubulin).
For less detailed structure, you can find its "FASTA" sequence. RCSB (find it on Google) will allow you to download the pdb file and the FASTA sequence for any known protein.
You can also find the original paper that described the amino acid sequence - just search Google. If you don't find it on Google, chances are you'll have to pay for it!
If you really don't mind which tubulin you get the structure of, use this one to save some time. It is the bovine (cow/cattle) alpha and beta tubulin monomers. The structure was derived as a dimer, so there are two sequences here. The first one is the beta chain, the second one is the alpha chain.
>1JFF:B|PDBID|CHAIN|SEQUENCE
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSY HGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTM DSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTE GAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTG SGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEP YNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTP TYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNM VPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE QMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMS ATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGE GMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEF EEEGEEDEA
>1JFF:A|PDBID|CHAIN|SEQUENCE
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPT VIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIG KEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGF TSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNS ILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTN LNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRG HFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMV KCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTI QFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCML SNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME EGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Wiki User
∙ 14y ago
Add your answer:
Earn +20 pts
What is the smallest structure between dipeptide amino acid polypeptide and protein?
Amino acid = Smallest building block of proteins; 20 of them. In this order. Amino acid < dipeptide ( two peptides ) < polypeptide (many peptides ) < Protein
Is amino acids a structure of RNA?
No, RNA is made of nucleic acid.
What type of molecule is the tRNA bring to the mRNA?
tRNA brings amino acids to the mRNA on the ribosome.
A picture of amino acid and its structure?
this is it's structure copy the link and paste in the address bar ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------http://www.protocolsupplements.com/Sports-Performance-Supplements/wp-content/uploads/2009/06/amino-acid-mcat1.png
A mutation that alters a single amino acid within a protein can alter?
the primary, secondary, and tertiary level of a protein structure because once an amino acid is effected by a mutation in a single amino acid it ruins the entire protein on all levels
Which amino acid helps in tubulin Cilia growth and function?
Glutamine is the amino acid that is involved in tubulin form and function.
What is the smallest structure of a animal?
Dipeptide,amino acid,polypeptide,protein Amino Acid is the answer
Why tyrosine is simple amino acid?
It is an nonessential amino acid but I would not call it's structure that simple.
What structure in DNA is an amino acid?
There is none. DNA is a nucleic acid composed of nucleotides. There are no amino acids in DNA.
Amino acid structural formula?
H2NCHRCOOH is the structure of an alpha-animo acid.
What the primary structure of myoglobin?
The amino-acid secquence of myoglobin is the primary structure.
Is an amino acid the smallest unit of structure of proteins?
Yes.
Which structure will become the product of translation?
The ribosome is the structure that facilitates translation in the cell. It reads mRNA and assembles a polypeptide chain by linking together amino acids in the correct order based on the instructions encoded in the mRNA.
What structure are in proteins?
The structure of preotein is (USUALLY) long strands of A.A (Amino Acid)
What is the form of structure for protein?
amino acid are the building block of proteins. Polypeptide are chains that bond amino acids to form protein structure
Is the secondary structure more polar than the linear amino acid sequence?
Protein tertiary structure is 3-D. Secondary structure is 2-D or linear. I. e. the linear a-a sequence is the secondary structure. Amino-acid monomers comprise the primary structure.
Is Pyruvic acid an amino acid?
NO!!! Pyruvic acid is a keto acid. It has the structure CH3 - C(=O) - COOH
