0
What else can I help you with?
What is special about the following order of numbers 854917610320?
The numbers in the sequence 854917610320 are arranged in alphabetical order thus: eight, five, four, nine, one, seven, six, ten, three, twenty.
The following number is the only one of its kind 8549176320 can you figure out What is is so special about it?
It contains all the digits from 0 to 9 and the numbers are placed in alphabetical order.
What is special about the following sequence of numbers 8 5 4 9 1 7 6 1 0 3 2 0?
there all in alphabetical order
How would you place the following number in order by integer and whole numbers -0.462 -56 735 0.326 8321 and 0?
From lowest to highest: -56 -0.462 0 0.326 735 8321
Identify the place occupied by the digit 6 in the following number 1 955 629?
The number 19,955,623 has eight places. In order from right to left they are: ones, tens, hundreds, thousands, ten thousands, hundred thousands, and millions. The number 6 is third from the right and therefore occupies the hundreds place.
Place the following in alphabetical order F2442 - 2?
2440
Can you Place the following in alphabetical order 1. F2442 - 2 2. F2444 - 3 3. F2424 - 3 4. F2443 - 3?
1. F2442 - 2 2. F2444 - 3 3. F2424 - 3 4. F2443 - 3
Place the following in alphabetical order 1. F2442 - 2 2. F2444 - 3 3. F2424 - 3 4. F2443 - 3 1342 3421 3142 1324 1. Gregory Marsha 2. Greggory Marietta 3. Gregery Marsha 4. Gregory Mary 3124 3142 231?
how can i solve this? 1. F2442 - 2 2. F2444 - 3 3. F2424 - 3 4. F2443 - 3 Answer----- 3,1,4,2
How do you alphabetically sort the following words place replace nine ninety side sidewalk face inside these tadpole enjoy display during sure whole?
The correct alphabetical order is:displayduringenjoyfaceinsidenineninetyplacereplacesidesidewalksuretadpolethesewhole
Which continent comes last when place alphabetical order?
South America
Which events take place in the olympic games in alphabetical order?
events
In order for production to take place the question of what is to be produced must be answered. Which of the following is another question that must be answered in order for production to take place?
how is production to be organized
Place the following in alphabetical 1 Gregory Marsha 2 Greggory Marietta 3 Gregery Marsha 4 Gregory Mary?
place in alphabetical order 1Gregory, Marsha 2. Greggory, Marietta 3. Gregery, Marsha 4. Gregory, Mary
What is list topics in alphabetical order a table contents or an Index?
Alphabetical order is a method of arranging topics or items based on the sequence of letters in the alphabet, from A to Z. This order helps readers easily locate specific topics within a table of contents or an index by following the alphabetical order of the words.
Place the following in alphabetical order 1-4123 2- 4132 3-1342 4-1423 1-kulas john 2-kulik john 3-kullas johnathan 4- kullas johnathan?
1342
What is filing skills?
To be able to place a collection of records in a convenient order for storage or reference- as in alphabetical order for example
What is a list of places on a map usually in alphabetical order?
An alphabetical list of place names (as at the back of an atlas) is called a gazetteer.
