1. Any living organism cannot live without foods. 2. A correct nutrition is good for the health. 3. Geography is important for your culture.
A good nutrition is IDK LOL somepne pleaze answer it pleaze LOLL LOVE ME <3 love me alots lol
light, nutrition, water
because it is good and bed
Bananas are a good source of potassium, which is important for muscle function and fluid balance in the body. Quinoa is a complete protein, meaning it contains all nine essential amino acids. Spinach is high in iron, important for oxygen transport in the body. Chia seeds are rich in omega-3 fatty acids, which are beneficial for heart health.
1.Good hygiene. 2.Nutrition? 3.Math and measurements.
1. By taking recommended nutrition each day, we reduce the risk of certain illnesses such as heart disease, diabetes, osteoporosis, certain cancers, and we increase the chance of a longer life. 2. Our immune system will be improved if we take the "right" kind of nutrition, because certain nutrients build up our immune system, providing us with resistance to viruses that other people we have come in contact with have. 3. It's much easier to get or to be fit if we have proper nutrition, because we will have the energy to exercise. 4. Proper nutrition allows us to do the things we want to do, like scuba diving or rock climbing, wind surfing, Being on a good diet makes strenuous activities easier because we have more energy and strength. 5. With good nutrition, our bodies look healthy. We are trim and lean, our skin looks healthy and clear, our nails are strong, and our hair is shiny and healthy looking. 6. I believe the most important thing for each of us, is to feel good, and good nutrition makes one feel good because we have all the nutrients to feed our cells with what they require.
The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater
The importance of good nutrition can be many answers. 1) you need to have a good nutrition to keep you thinking straight. That is why you should have a good sized breakfast with plenty of fruit. 2) Good nutrition also means taking care of your body, which means, mostly, exercise. 3)with all of this exercise you MUST DRINK PLENTY OF WATER!!!!!!!!!!!! (even if you don't exercise you should be drinking water. Your body is mostly made up of it and needs it to function properly.) 4) A good nutrition can help you have a more active lifestyle. Which can end up being pretty fun, odds are that you will find some type of sport or activity that you'll really like. Also, exercise makes you happy, which means you can also have a healthy well-being, which we always want. 5) Now to sum things up, a good nutrition will stay with you till you're old. So if you make good choices now, you wont regret it when you're older. Because everything that you do now will affect you later (for example if you brake a bone when you're say, 15, well when your 50, your gunna be hurtin! so be smart, please.) so start getting that good nutrition and things will improve. You'll see!
1.nutrients 2.plant food 3.energy for plants animals and bacteria
different characteristics of living organisms are: 1. respiration 2. nutrition 3. excretion 4. reproduction 5. growth different characteristics of living organisms are: 1. respiration 2. nutrition 3. excretion 4. reproduction 5. growth
The 3 important things he used in his paintings are color,patterns,and lines.