0
Add your answer:
Earn +20 pts
Is geography and food and nutrition needed?
1. Any living organism cannot live without foods. 2. A correct nutrition is good for the health. 3. Geography is important for your culture.
How is a good nutrition promoted?
A good nutrition is IDK LOL somepne pleaze answer it pleaze LOLL LOVE ME <3 love me alots lol
Give 3 things plants will compete with each other?
light, nutrition, water
What are 3 good things about fossil fuels and 3 bad things?
because it is good and bed
I am applying to med school and in my personal statement I want to highlight amongst other things the fact that I am a keen and frequent baker so how can I link baking and good medical practice?
1.Good hygiene. 2.Nutrition? 3.Math and measurements.
What are six good reasons to concentrate on good nutrition?
1. By taking recommended nutrition each day, we reduce the risk of certain illnesses such as heart disease, diabetes, osteoporosis, certain cancers, and we increase the chance of a longer life. 2. Our immune system will be improved if we take the "right" kind of nutrition, because certain nutrients build up our immune system, providing us with resistance to viruses that other people we have come in contact with have. 3. It's much easier to get or to be fit if we have proper nutrition, because we will have the energy to exercise. 4. Proper nutrition allows us to do the things we want to do, like scuba diving or rock climbing, wind surfing, Being on a good diet makes strenuous activities easier because we have more energy and strength. 5. With good nutrition, our bodies look healthy. We are trim and lean, our skin looks healthy and clear, our nails are strong, and our hair is shiny and healthy looking. 6. I believe the most important thing for each of us, is to feel good, and good nutrition makes one feel good because we have all the nutrients to feed our cells with what they require.
What are the three basic elements of good nutrition?
The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater
List the five features that describe living things?
1 growth 2 absorption of nutrition 3 respiration 4 reproduction 5 movement
What pp-table of content-food 3 nutrition?
what pp-table of content-food 3 nutrition
Tell three ways that soil is important?
1.nutrients 2.plant food 3.energy for plants animals and bacteria
How does good nutrition enhance and maintain personal health throughout life?
The importance of good nutrition can be many answers. 1) you need to have a good nutrition to keep you thinking straight. That is why you should have a good sized breakfast with plenty of fruit. 2) Good nutrition also means taking care of your body, which means, mostly, exercise. 3)with all of this exercise you MUST DRINK PLENTY OF WATER!!!!!!!!!!!! (even if you don't exercise you should be drinking water. Your body is mostly made up of it and needs it to function properly.) 4) A good nutrition can help you have a more active lifestyle. Which can end up being pretty fun, odds are that you will find some type of sport or activity that you'll really like. Also, exercise makes you happy, which means you can also have a healthy well-being, which we always want. 5) Now to sum things up, a good nutrition will stay with you till you're old. So if you make good choices now, you wont regret it when you're older. Because everything that you do now will affect you later (for example if you brake a bone when you're say, 15, well when your 50, your gunna be hurtin! so be smart, please.) so start getting that good nutrition and things will improve. You'll see!
How important is nutrition?
Nutrition is very very important. Many people do not know, but it is. It is very important that people have atleast 3-4 servings of fruits every day, and 4-5 servings of veggies every day. Vitamins such as Vitamin D3, Vitamin C, and many others are very important. If you are someone looking to lose weight, then you would need a high protein and carbohydrate diet and alot of working out at the gym is necassary. But nutrition is mainly everything your body needs.
