answersLogoWhite

0

What are basic nutrition?

User Avatar

Anonymous

15y ago
Updated: 8/18/2019

Nutrients: Calories,Fat,Cholesterol,Sodium,Potassium,Carbohydrates and Protein Vitamins: A,C,D,E Minerals: Calcium,Iron,Thiamin,Riboflavin,Folic Acid, and Zince

User Avatar

Wiki User

15y ago

What else can I help you with?

Related Questions

5 basic building blocks of nutrition?

five basic building blocks of nutrition


What are the Basic tools in nutrition?

THE basic tools in study of nutrition are: *Nutrition guidelines *Food exchange list *Dietary standard & Nutrient Density *Nutrition Facts *Food composition table


What are two basic types of nutrition?

There are primary forms of nutrients, macronutrients and micronutrients. The three main classes of macronutrients encompass carbohydrate, protein, and fat. The forms of micronutrients are vitamins and minerals, and those are greater molecules that cells need to make power.


Basic tools in nutrition?

The basic tools in nutrition mainly revolve around diet and exercises. These will define the components of your diet and the relevant exercises that will keep you healthy and fit.


What are the basic tools of nutrition?

Nutrition guidelines *Food exchange list *Dietary standard & Nutrient Density *Nutrition Facts *Food composition table


What effect does basic nutrition have on your fitness?

nutrtition helps lol


What is a reliable nutrition database?

http://www.nutritionco.com/ is a reliable nutrition database. It gives you basic guidelines for nutrition, and it also gives you ways to apply them to your everyday life, and to make informed nutrition decisions.


Is phagocytosis autotrophic nutrition or heterotrophic nutrition?

heterotrophic in very basic, general terms: it "engulfs" it's prey. (like an amoeba!)


What are the three basic elements of good nutrition?

The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater


Where can I find information about basic nutrition facts?

Nutrition.Gov is an excellent place to get the basic nutrition facts for a better diet. Also the Mayo Clinic is a resourceful place to find answers for many questions on diet and nutritional facts.


What foods give us a balance of nutrition?

The four basic food groups will do this for you.


What is the basic component of total parental nutrition for a burn patient?

Trace element