0
food
Wiki User
∙ 11y ago
Add your answer:
Earn +20 pts
What ology is the study of food diet and nutrition from the greek meaning food grain?
Sounds like Gastronomy or Molecular Gastronomy
How can i maintain good nutrition while dieting?
The simple way of maintaining good nutrition while on a diet is to keep track of what you eat by maintaining a journal. Then, compare what you are eating to the USDA's recommended five food group portions. This will help you balance your diet and the proper nutrition.
What are the importance of studying food science?
To have proper knowledge about nutrition,food elements. It helps to know about daily requirement of nutrients. To have knowledge about balance diet, food absorption etc. food preparation n preservation can also learn form it.
What is a balance deit or what?
a balance diet is one with three or more food groups in your meal or diet. c;
What has the author Myron Winick written?
Myron Winick has written: 'For mothers & daughters' -- subject(s): Nutrition, Women 'Your personalized health profile' -- subject(s): Diet, Diet therapy, Food habits, Health, Nutrition, Popular works, Probability, Food Habits 'Nutrition in Health and Disease (Current Concepts in Nutrition, Vol 17)' 'The fiber prescription' -- subject(s): High-fiber diet 'Early Nutrition and Brain Development (Biological Readers)' 'Nutrition in health and disease' -- subject(s): Diet in disease, Diet therapy, Nutrition, Nutrition disorders
What is a list of fulfilling foods for a diet?
List the essential food a balance diet
What are the three basic elements of good nutrition?
The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater
What foods give us a balance of nutrition?
The four basic food groups will do this for you.
What you mean by balance diet?
A balance of healthy carbohydrates, fats, and protein. All eaten in a portion fit to your calorie needs throughout the day, in intervals (for some people this means bigger portions for breakfast, lunch and dinner...and others it means smaller portions, more frequently throughout the day) email if you need help with more nutrition questions: halo_nariko@yahoo.com
On a food's nutrition label the term Diet means that?
its some many disjadsdbsbcvnkfnv
What has the author Novella S Hill written?
Novella S Hill has written: 'Spending your food dollar wisely for good nutrition' -- subject(s): Nutrition, Diet 'Post gastrectomy diet' -- subject(s): Nutritional aspects, Gastrectomy, Stomach, Diseases, Diet 'Fat controlled, cholesterol restricted diet' -- subject(s): Low-cholesterol diet, Low-fat diet, Diet 'Good eating' -- subject(s): Food habits, Diet 'Dental soft diet' -- subject(s): Nutrition and dental health, Diet 'US dietary guidelines and a prudent diet' -- subject(s): Nutrition, Diet
Is the nutrition pyramid good to follow for better eating habbits?
Yes, the nutrition pyramid is good to follow for better eating habits. The food pyramid contains all of the different food groups you need to include in your diet. Each food group has been scientifically measured so that you receive the nutrition you need in your diet.
