0
What are the three macromolecules your body needs for proper nutrition?
Wiki User
∙ 12y ago
wala
Wiki User
∙ 12y ago
Add your answer:
Earn +20 pts
What is a protein trimer?
In biochemistry, a trimmer is defined as a macromolecular complex that is formed by three macromolecules like nucleic acids or proteins. The three macromolecules are usually non-covalently bound.
What three elements are found in macromolecules?
carbon,hydrogen and oxygen
What are the organic macromolecules in different types of foods?
Foods contain proteins, carbohydrates and lipids which are three different types of macromolecules. However, there are far more than three types of macromolecules, some of which are also found in food.
What element are found in all macromolecules of life?
There are three elements. they are C,H,and O.
What macromolecules is often made of three acids bound to a glycerol molecule?
They are the lipids. They are the monomers of lipids
What are the three components to maintain weight?
proper nutrition, proper amount of sleep, proper amount of exercize
Does fire requires nutrition?
A fire needs three things: fuel, oxygen, and heat. If fuel can be considered "nutrition" then yes it does require nutrition.
What are three benefits of prpoer nutrition?
it promotes proper formation of the bones and other body tissues
What is a protein trimer?
In biochemistry, a trimmer is defined as a macromolecular complex that is formed by three macromolecules like nucleic acids or proteins. The three macromolecules are usually non-covalently bound.
Can a dwarf hamster live for 4 hours?
Definatly. In fact, they can live for two to three years if given proper nutrition (diet), and care
What is the name of three macromolecules?
proteins, starch, nucleic acids
What three elements are found in macromolecules?
carbon,hydrogen and oxygen
What are the organic macromolecules in different types of foods?
Foods contain proteins, carbohydrates and lipids which are three different types of macromolecules. However, there are far more than three types of macromolecules, some of which are also found in food.
What are the three basic elements of good nutrition?
The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater
What are three trace elements your body needs trace amounts of for proper functioning?
calcium, potassium, and sulfur
What are three kinds of macromolecules?
Actually there are four. They are carbohydrates,proteins,lipids and nucleic acids
What elements are found in all macromolecules?
There are three common elements: C, H, and O.
