0
Describes the portion of the energy intake that should come from each macronutrient
AMDR in Nutrition stands for Acceptable Macronutrient Distribution Ranges.It can also be understood as the calorie composition of a diet that gives adequate energy as required and other nutrients. For example AMDR for carbohydrate is 45%-65%, fat is 20%-35% and of protein is 10%-35% of your total Kcal intake.
Wiki User
∙ 14y ago
Wiki User
∙ 9y agoIn nutrition terms, AMDR stands for Acceptable Macronutrient Distribution Range. It helps determine what percent of your calories should be a particular food. For instance, carbohydrates should only account for 45 to 65 percent of your daily caloric intake.
Wiki User
∙ 15y agoI believe it's between 20-35% of your daily caloric needs.
Wiki User
∙ 13y agoThe Acceptable Macronutrient Density Range for Carbohydrates is based on a percentage range of carbohydrates needed based on total calories. The range is 45-65% of total calorie intake.
Wiki User
∙ 11y agoAcceptable Macronutrient Distribution Ranges
Add your answer:
Earn +20 pts
What is the AMDR for protein?
10-35%
What is the importance of proper nutrition that eradicates malnutrition?
Malnutrition means "bad nutrition", which can be corrected by proper nutrition.
What does ''slice'' means in food and nutrition?
It basically just means cut.
What does nutritions means?
Nutrition is the supply of essential food nutrients in sufficient amount in right proportion to the need and requirement of the body.
UL means in dite and nutrition?
UL = Upper Limit
Is nutrition the same thing as biology?
2000 in the bible means 2000!
In nutrition what is an important means of maintaining your health?
Eat a balanced diet.
What is over nutrition and under nutrition?
Over nutrition is when you eat too many calories and under nutrition is when you don't eat enough. Malnutrition means you're eating enough calories but aren't getting the right amounts of required vitamins and nutrients.
What is amdr for fat?
10-35% of your daily calorie intake or approx. 0.8 g/kg for the average adult
What are the three basic elements of good nutrition?
The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater
In nutrition the word essential means?
necessary nutrient that can be obtained only from the diet.
On a food's nutrition label the term Diet means that?
its some many disjadsdbsbcvnkfnv
