answersLogoWhite

0

Filipinos are labor oriented provoding them a need for energy and muscle strength, i suggest a diet concentrated on protein and less carbs The effects of improper nutrition is appearing more and more in our population because in the current century, people are living longer. There are more cases of degenerative diseases like cardiovascular diseases (Heart disease, stroke, hypertension) and cancer than in the past. Killer diseases wherein we do not have a cure can be seen in the very high rate of death in the population that develop these diseases. Based on DOH statistics for 1991, eight Filipinos die out of ten who get sick of heart disease and six die out of ten who develop cancer. Pneumonia, the greatest killer of Filipinos, has a Death Rate of only 1-2 out of 10 who develop the disease. The best approach to the management of incurable diseases is primary prevention. Since, degenerative diseases can be traced back to a lifestyle that includes poor nutrition, primary prevention of nutrition-related diseases should be initiated early in life. Lifestyle consists of habits and nutritional-lifestyle consists of eating habits with regards to choice and how we prepare our food. A nutritional-lifestyle or behavioral change consists of changing our choices of what we put into our mouth. Our food behavior is influenced by many factors; * genetic makeup (ethnic identity) * knowledge on nutrition (occupation, education) * behavior * perception (health beliefs, religious beliefs) * environment (childhood experiences, peer influences, where we live, food flavor, food texture, food appearance, availability, convenience) * status (health status, income) The philosophy behind a healthy diet consists of three principles; namely, (1) variety within a food group, (2) pyramidal balance from the five major food groups, and (3) moderate intake of favorite foods rich in salt, sugar and fat. The five food groups are: (pyramidal proportions in parenthesis) * milk, yogurt, and cheese (2-3 servings/day) * meat, poultry, fish, dry beans, eggs, and nuts (2-3 servings/day) * fruits (2-4 servings/day) * vegetables (3-5 servings/day) * bread, cereal, rice, and pasta (6-11 servings/day) The suggested servings will provide from 1600 kcal/day at the lower values of the recommended serving range to 2800 kcal/day at the higher values of the recommended serving range. Fruits and vegetables should be raw. Bread and cereal should be from whole grain. Rice should be unpolished.

User Avatar

Wiki User

16y ago

What else can I help you with?

Related Questions

5 basic building blocks of nutrition?

five basic building blocks of nutrition


What are the Basic tools in nutrition?

THE basic tools in study of nutrition are: *Nutrition guidelines *Food exchange list *Dietary standard & Nutrient Density *Nutrition Facts *Food composition table


Basic values of filipinos?

Filipinos are strong in their values. They are hospital, friendly, helpful, warm, cheerful, obedient. These values are stronger in older people than the young generation.


What are two basic types of nutrition?

There are primary forms of nutrients, macronutrients and micronutrients. The three main classes of macronutrients encompass carbohydrate, protein, and fat. The forms of micronutrients are vitamins and minerals, and those are greater molecules that cells need to make power.


Basic tools in nutrition?

The basic tools in nutrition mainly revolve around diet and exercises. These will define the components of your diet and the relevant exercises that will keep you healthy and fit.


Why filipino is small?

There is no scientific evidence to suggest that Filipinos are inherently small as a population. Height can be influenced by a variety of factors including genetics, nutrition, and overall health. Filipinos, like people of any ethnicity, come in a range of heights.


What are the basic tools of nutrition?

Nutrition guidelines *Food exchange list *Dietary standard & Nutrient Density *Nutrition Facts *Food composition table


What effect does basic nutrition have on your fitness?

nutrtition helps lol


What is a reliable nutrition database?

http://www.nutritionco.com/ is a reliable nutrition database. It gives you basic guidelines for nutrition, and it also gives you ways to apply them to your everyday life, and to make informed nutrition decisions.


Is phagocytosis autotrophic nutrition or heterotrophic nutrition?

heterotrophic in very basic, general terms: it "engulfs" it's prey. (like an amoeba!)


Why is it important that Filipinos should know and understand the basic laws in the Philippines?

Because it's safe :D joke


What are the three basic elements of good nutrition?

The 3 basic elements of good nutrition are:Proper hydrationEating a healthy diet (and this means more than just getting the right amount of calories)Vitamin/Mineral SupplementationEating healthy means you get the proper balance of:carbohydratesfatsvitaminsmineralsproteinswater